ChemicalBook >> CAS DataBase List >>Teriparatide acetate

Teriparatide acetate

CAS No.
52232-67-4
Chemical Name:
Teriparatide acetate
Synonyms
Parathar;hPTH (1-34);Teroparatide;CNV-38d(1-34);Teriparatide CRS;PTH (HUMAN, 1-34);Teriparatida(net);PTH (1-34) (HUMAN);Parathormone (1-34);Teriparatide acetate
CBNumber:
CB2284468
Molecular Formula:
C172H278N52O47S2
Molecular Weight:
3890.49792
MDL Number:
MFCD00149013
MOL File:
52232-67-4.mol
MSDS File:
SDS
Last updated:2024-05-14 17:56:46

Teriparatide acetate Properties

Melting point >205oC (dec.)
RTECS SQ7770000
storage temp. −20°C
solubility DMSO (Slightly), Water (Slightly)
form powder
color White to Off-White
Water Solubility Soluble to 0.40 mg/ml in water
Sequence H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability Hygroscopic
CAS DataBase Reference 52232-67-4(CAS DataBase Reference)
FDA UNII 10T9CSU89I

SAFETY

Risk and Safety Statements

Symbol(GHS)  GHS hazard pictograms
GHS07
Signal word  Warning
Hazard statements  H302-H227
Precautionary statements  P210-P264-P270-P280-P301+P312-P330-P370+P378-P403+P235-P501
WGK Germany  3
HS Code  2937190000

Teriparatide acetate price More Price(27)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich Y0001916 Teriparatide European Pharmacopoeia (EP) Reference Standard 52232-67-4 Y0001916 $201 2024-03-01 Buy
Sigma-Aldrich P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 52232-67-4 0.1mg $178 2024-03-01 Buy
Sigma-Aldrich P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 52232-67-4 0.5mg $271 2024-03-01 Buy
Sigma-Aldrich 1643962 Parathyroid Hormone Fragment 1-34 human 52232-67-4 1mg $1530 2024-03-01 Buy
Sigma-Aldrich 05-23-5501 Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca2+ and phosphate metabolism. 52232-67-4 1mg $433 2024-03-01 Buy
Product number Packaging Price Buy
Y0001916 Y0001916 $201 Buy
P3796 0.1mg $178 Buy
P3796 0.5mg $271 Buy
1643962 1mg $1530 Buy
05-23-5501 1mg $433 Buy

Teriparatide acetate Chemical Properties,Uses,Production

Application in Particular Diseases

In Osteoporosis:

  • Teriparatide is a recombinant product representing the first 34 amino acids in human parathyroid hormone. Teriparatide increases bone formation, the bone remodeling rate, and osteoblast number and activity. Both bone mass and architecture are improved.
  • Teriparatide is FDA approved for postmenopausal women and men who are at high risk for fracture. Candidates for therapy include patients with a history of osteoporotic fracture, multiple risk factors for fracture, very low bone density (e.g., T-score <–3.5), or those who have failed or are intolerant of previous bisphosphonate therapy.
  • The drug reduces fracture risk in postmenopausal women, but no fracture data are available in men. Lumbar spine BMD increases are higher than with any other osteoporosis therapy. Although wrist BMD is decreased, wrist fractures are not increased.
  • Discontinuation of therapy results in a decrease in BMD, but some antifracture efficacy appears to be maintained. Sequential therapy with teriparatide followed by an antiresorptive agent (e.g., bisphosphonate) should be considered to maintain BMD gains.
  • The dose is 20 mcg administered subcutaneously in the thigh or abdominal area (see Table 3-4). The initial dose should be given with the patient either lying or sitting, in case orthostatic hypotension occurs. Each prefilled 3-mL pen device delivers a 20-mcg dose each day for up to 28 days; the pen device should be kept refrigerated.
  • Transient hypercalcemia rarely occurs. A trough serum calcium concentration is recommended 1 month after initiation of therapy.
  • Teriparatide is contraindicated in patients at baseline increased risk for osteosarcoma (e.g., Paget’s bone disease, unexplained alkaline phosphatase elevations, pediatric patients, young adults with open epiphyses, or patients with prior radiation therapy involving the skeleton).

Uses

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

General Description

Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.

Biological Activity

parathyroid hormone (1-34) (human), (c181h291n55o51s2), a peptide with the sequence h2n-svseiqlmhnlgkhlnsmervewlrkklqdvhnf-oh, mw= 4117.72. parathyroid hormone (pth), parathormone or parathyrin, is secreted by the chief cells of the parathyroid glands as a polypeptide containing 84 amino acids. it acts to increase the concentration of calcium (ca2+) in the blood, whereas calcitonin (a hormone produced by the parafollicular cells (c cells) of the thyroid gland) acts to decrease calcium concentration. pth acts to increase the concentration of calcium in the blood by acting upon the parathyroid hormone 1 receptor and the parathyroid hormone 2 receptor(1). parathyroid hormone regulates serum calcium, it enhances the release of calcium from the large reservoir contained in the bones(2). it enhances active reabsorption of calcium and magnesium from distal tubules and the thick ascending limb(3). it enhances the absorption of calcium in the intestine by increasing the production of activated vitamin d.figure1 formula of parathyroid hormone (1-34) (human)figure2 the parathyroid hormone (pth) system

Biochem/physiol Actions

Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone, increasing the calcium:phosphate ratio in the kidney and promoting the absorption of calcium by the intestines. PTH is an anabolic agent that improves osteoblastic bone development. PTH 1-34 induces bone morphogenetic protein (BMP) gene transcription. Active N-terminal fragment of PTH (residues 1–34), has been used as a therapeutic for postmenopausal women with osteoporosis who are at high risk for fracture.

Pharmacokinetics

If administered once daily or intermittently, teriparatide preferentially enhances osteoblastic function,and bone formation occurs. Continuous exposure to endogenous PTH may result in poor skeletal composition because of enhanced osteoclast-mediated bone resorption. After 18 months of treatment, lumbar BMD increased up to 12% in postmenopausal women. After 10 months of treatment, 53% of men had an increase of 5% or greater in spine BMD. The risk for developing new vertebral fractures was reduced by 65% after 21 months of treatment, and the number of nonvertebral fragility fractures was reduced by 53%.

Clinical Use

In 2002, the U.S. FDA approved teriparatide for the treatment of postmenopausal osteoporosis in patients who have a high risk of fracture as well as to increase bone mass in men with primary or hypogonadal osteoporosis who have a high risk of fracture. Teriparatide is recombinant human PTH 1-34, the biologically active portion of the endogenously produced preprohormone. Unlike the bisphosphonates, which are classified as bone restorative agents, teriparatide is the first approved bone-forming agent. Bone formation is possible because of the ability of this agent to increase the number of osteoblasts. Although teriparatide enhances the function of both osteoclasts and osteoblasts, the exposure incidence dictates its effect on the skeleton.

Side effects

Temporary increases in serum calcium levels occur following administration of teriparatide. As a result, this agent is contraindicated in patients who are predisposed to hypercalcemia. Some evidence suggests that these elevations in serum calcium levels may cause a patient who is taking digitalis to experience digitalis toxicity (39). Teriparatide should not be prescribed to patients with Paget's disease, children, young adults, women who are pregnant or nursing, and those patients who have received skeletal radiation therapy. Because of an increased incidence of osteosarcoma (malignant bone tumors) observed in rats, teriparatide also carries a black box warning

storage

Store at -20°C

Dosage

Teriparatide acetate requires subcutaneous injection into the thigh or abdominal wall, and the recommended dose is 20 mcg once daily. If symptoms of orthostatic hypotension occur, it is administered while the patient is sitting or lying down. It is not recommended to use the drug for more than 2 years in the lifetime of the patient. Use teriparatide injection with caution in patients receiving digoxin. Transient hypercalcemia may predispose patients to digitalis toxicity.

Teriparatide acetate Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 399)Suppliers
Supplier Tel Email Country ProdList Advantage
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
qingdao future trading Co., Ltd
+86-13335044410 +86-13335044410 cui56813@163.com China 110 58
Hebei Xinsheng New Material Technology Co., LTD.
+86-16632316109 xinshengkeji@xsmaterial.com China 1100 58
Zibo Hangyu Biotechnology Development Co., Ltd
+86-0533-2185556 +8617865335152 Mandy@hangyubiotech.com China 11013 58
Hebei Anlijie Biotechnology Co., Ltd
+8619031013551 ably@aljbio.com China 196 58
Hebei Weimiao Import and Export Trade Co., Ltd.
+undefined19948166995 sale01@hbweimiao.com China 73 58
Shanghai Getian Industrial Co., LTD
+86-15373193816 +86-15373193816 mike@ge-tian.com China 274 58
Shaanxi TNJONE Pharmaceutical Co., Ltd
+8618740459177 sarah@tnjone.com China 1142 58
Shanghai Chinqesen Biotechnology Co., Ltd.
+86-16628886292 +86-19521323435 sales2@qschem-pharma.com China 46 58
Shanghai Yunao International Trade Co., Ltd
+8617621705551 asdf@shanghaihg.cn China 265 58

Related articles

View Lastest Price from Teriparatide acetate manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
Teriparatide acetate pictures 2024-06-10 Teriparatide acetate
52232-67-4
US $1.00 / g 1g 99% 100kg Dorne Chemical Technology co. LTD
Teriparatide pictures 2024-06-09 Teriparatide
52232-67-4
US $1.00-9.90 / g 1g 99% 100kg Wuhan Cell Pharmaceutical Co., Ltd
Teriparatide acetate pictures 2024-06-07 Teriparatide acetate
52232-67-4
US $30.00 / box 1box 99% 2000kg hebei hongtan Biotechnology Co., Ltd
  • Teriparatide pictures
  • Teriparatide
    52232-67-4
  • US $1.00-9.90 / g
  • 99%
  • Wuhan Cell Pharmaceutical Co., Ltd

Teriparatide acetate Spectrum

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34 PARATHYROID HORMONE (HUMAN, 1-34) PARATHYROID HORMONE (1-34), HUMAN PTH (HUMAN, 1-34) Teriparatide acetate SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN Pth(1-34)(human) Acetate Parathormone (1-34) [CYS5,28] PARATHYROID HORMONE (1-34), HUMAN [CYS5,28] PTH (1-34), HUMAN H-SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH Teriparatide (Forteo) PARATHYROID HORMONE FRAGMENT HUMAN 1-34 APPROX. 95% PARATHYROID HORMONE FRAGMENT HUMAN 1-34 90-95% Teriparatide, Parathyroid Hormone(1-34),human parathyroid hormone fragment 1-34 human PARATHYROID HORMONE (PTH) HUMAN 1-34, MIN 95% (1-34)-HUMAN PARATHYROID HORMONE Teriparatide, Parathyroid Hormone(1-34) ALA-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ALA-SER-VAL-GLU-ARG-MET-GLN-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF SER-VAL-SER-GLU-CYS-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-CYS-GLN-ASP-VAL-HIS-ASN-PHE Teriparatide acetate/HuMan PTH(1-34) M.W. 4117.72 C181H291N55O51S2 Parathyroid Hormone Fragment (1-34) H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt PTH (1-34) (HUMAN) Parathyroid Hormone (PTH) (1-34), Human Teroparatide CNV-38d(1-34) Teriparatide, Teriparatida , Teriparatidum Teriparatide (PTH 1-34) hPTH (1-34) PTH 1-34;HPTH (1-34);HUMAN PARATHYROID HORMONE-(1-34) Pterospermum heterophyllum Hance. Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34), >99% Teriparatide CRS Teriparatide?Acetate impurity Teriparatide acetate USP/EP/BP Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34) Teriparatide Acetate/pTH(1-34) human Pteris formosana extract Teriparatide D10 AcetateQ: What is Teriparatide D10 Acetate Q: What is the CAS Number of Teriparatide D10 Acetate Q: What is the storage condition of Teriparatide D10 Acetate Q: What are the applications of Teriparatide D10 Acetate TeriparatideAcetateQ: What is TeriparatideAcetate Q: What is the CAS Number of TeriparatideAcetate Q: What is the storage condition of TeriparatideAcetate Q: What are the applications of TeriparatideAcetate Teriparatida(net) pTH (1-34) (human) Acetate(net) Teriparatide (COLD SHIPMENT REQUIRED) (1643962) Teriparatide (Y0001916) Teriparatide for system suitability (Y0001895) leriparatide acetate TeripaRatide Acetate peptide Terliparatide Acetate Teriparatide acetate Powder CNV-38d(1-34),Parathyroid Hormone (1-34), human Parathar 52232-67-4