Obtustatin
- CAS No.
- Chemical Name:
- Obtustatin
- Synonyms
- Obtustatin;CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG(MODIFICATIONS: DISULFIDE BRIDGE: 1-10,6-29,7-34,19-36)
- CBNumber:
- CB43367986
- Molecular Formula:
- Molecular Weight:
- 0
- MDL Number:
- MOL File:
- Mol file
Obtustatin Chemical Properties,Uses,Production
Enzyme inhibitor
This 41-residue disintegrin (FW = 4401 g/mol; Sequence CTTGPCCRQ CKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG, with disulfide bonds at Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, and Cys19-Cys36) from the venom of the blunt-nosed viper Vipera lebetina obtusa exhibits tight binding to integrins, inhibiting platelet aggregation, IC50 = 2 nM. It is the shortest polypeptide to contain an integrin-recognition loop. Target(s): Obtustatin is a highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen), displaying specificity for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7.
Obtustatin Preparation Products And Raw materials
Raw materials
Preparation Products
Obtustatin Suppliers
Global( 21)Suppliers
Supplier | Tel | Country | ProdList | Advantage | |
---|---|---|---|---|---|
BOC Sciences | +1-631-485-4226 | inquiry@bocsci.com | United States | 19553 | 58 |
Shanghai Longyu Biotechnology Co., Ltd. | +8615821988213 | info@longyupharma.com | China | 2531 | 58 |
Wuxi Zhongkun Biochemical Technology Co., Ltd. | 0510-85629785 18013409632 | sales@reading-chemicals.com | China | 15185 | 58 |
Creative Peptides | info@creative-peptides.com | United States | 6084 | 56 | |
Hangzhou Peptidego Biotech Co.,Ltd. | 0571-87213919 | eric@peptidego.com | China | 6347 | 58 |
Wuxi Helen Biotechnology Co., Ltd., | 0510-85629785 18013409632 | sales@reading-chemicals.com | China | 14092 | 58 |
Nanjing Yuanpeptide Biotech Co.,Ltd. | 18168071971 | support@yuan-peptide.com | China | 2977 | 58 |
Shaoxing Junyu Biotechnology Co., LTD | 0571-88211921 15572296305 | sales4@gotopbio.com | China | 5144 | 58 |
Hangzhou Sinoda Pharmaceutical Technology Co. LTD | 0571-87213919 17306812703 | 3007955328@qq.com | China | 5950 | 58 |
Shanghai HongTide Biotechnology Co.,Ltd. | 19961912513 | sales@hongtide.com | China | 4553 | 58 |
CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG(MODIFICATIONS: DISULFIDE BRIDGE: 1-10,6-29,7-34,19-36)
Obtustatin