ChemicalBook >> CAS DataBase List >>GLP-2 (HUMAN)

GLP-2 (HUMAN)

CAS No.
99120-49-7
Chemical Name:
GLP-2 (HUMAN)
Synonyms
GLP-2;HR-34;glp-2-arg;GLP-2 (1-34);GLP-2 (HUMAN);GLP-2 (1-34) (HUMAN);GLP-2 (1-33) (HUMAN);223460-79-5/89750-15-2;Preproglucagon 126-159;GLUCAGON-LIKE PEPTIDE-2
CBNumber:
CB7337473
Molecular Formula:
C171H266N48O56S1
Molecular Weight:
3922.29
MDL Number:
MFCD00081649
MOL File:
Mol file
Last updated:2023-04-23 13:52:06

GLP-2 (HUMAN) Properties

storage temp. −20°C
form solid

SAFETY

Risk and Safety Statements

Safety Statements  22-24/25
WGK Germany  3

GLP-2 (HUMAN) price More Price(4)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich G8166 Glucagon-Like Peptide 2 -Arg human trifluoroacetate salt >90% (HPLC), solid 99120-49-7 0.5mg $222.4 2024-03-01 Buy
Alfa Aesar J66884 Glucagon-Like Peptide-2, human 99120-49-7 1mg $313 2021-12-16 Buy
Alfa Aesar J66884 Glucagon-Like Peptide-2, human 99120-49-7 0.5mg $197 2021-12-16 Buy
Usbiological G2040-37H Glucagon-like Peptide 2, Human 99120-49-7 500ug $631 2021-12-16 Buy
Product number Packaging Price Buy
G8166 0.5mg $222.4 Buy
J66884 1mg $313 Buy
J66884 0.5mg $197 Buy
G2040-37H 500ug $631 Buy

GLP-2 (HUMAN) Chemical Properties,Uses,Production

Uses

Glucagon-Like Peptide 2 (GLP-2) -Arg human trifluoroacetate salt has been used for injection in chickens to determine the effects of GLP-2 on the weight and morphology of small intestines.

General Description

Glucagon-like peptide 2 (GLP-2) is a member of the pro-glucagon gene family which is released in small and large intestinal circulation by enteroendocrine L cells. This peptide is composed of 33 amino acids.

Biochem/physiol Actions

Glucagon-like peptide 2 (GLP-2) influences the functionality of gastrointestinal tract by participating in the feedback loop to the brain for the control of food intake. It also controls digestion and absorption, and has tropic effects post chemotherapy injury or surgical resection. This peptide is also responsible for epithelial cell proliferation of the small bowel. Studies in rats show that this peptide enhances the effects of the ileal-brake hormones, GLP-1 and peptide YY. It also negatively regulates gastrointestinal motility and secretion. Thus, it has potential as a therapeutic agent in short-bowel syndrome.

GLP-2 (HUMAN) Preparation Products And Raw materials

Raw materials

Preparation Products

GLP-2 (HUMAN) Suppliers

Global( 93)Suppliers
Supplier Tel Email Country ProdList Advantage
Alpha Biopharmaceuticals Co., Ltd
+86-411-39042497 +8613921981412 sales@alphabiopharm.com China 886 58
Shenzhen Nexconn Pharmatechs Ltd
+86-755-89396905 +86-15013857715 admin@nexconn.com China 10247 58
Hubei xin bonus chemical co. LTD
86-13657291602 linda@hubeijusheng.com CHINA 22968 58
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
career henan chemical co
+86-0371-86658258 15093356674; factory@coreychem.com China 29826 58
Fuxin Pharmaceutical
+86-021-021-50872116 +8613122107989 contact@fuxinpharm.com China 10297 58
Hebei Yanxi Chemical Co., Ltd.
+8617531190177 peter@yan-xi.com China 6011 58
Dideu Industries Group Limited
+86-29-89586680 +86-15129568250 1026@dideu.com China 27644 58
Hangzhou Go Top Peptide Biotech
0571-88211921 sales1@gotopbio.com CHINA 2609 58
Chengdu Youngshe Chemical Co., Ltd.
+8618108235634 Cecilia@youngshechem.com China 2345 58

View Lastest Price from GLP-2 (HUMAN) manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
GLP-2 (HUMAN) pictures 2020-02-19 GLP-2 (HUMAN)
99120-49-7
US $7.00 / KG 1KG 99% 100kg Career Henan Chemical Co
HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-ARG Glucagon-Like Peptide II, (1-34), human HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-ARG: HADGSFSDEMNTILDNLAARDFINWLINTKITDR GLP-2 (1-34) (huMan) Proglucagon (126-159) (huMan), Preproglucagon (146-179) (huMan), Glucagon-Like Peptide 2-Arg (huMan) Proglucagon (126-159) (huMan), Preproglucagon (146-179) (huMan), Glucagon-Like Peptide 2-Arg (huMan) GLP-2 (1-34) (HUMAN) GLP-2-Arg, Preproglucagon 126-159 Preproglucagon 126-159 HADGSFSDEMNTILDNLAARDFINWLIQTKITDR H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-ARG-OH H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP GLUCAGON-LIKE PEPTIDE-2 GLUCAGON-LIKE PEPTIDE 2 ARG (HUMAN) GLUCAGON-LIKE PEPTIDE 2 (HUMAN) GLUCAGON-LIKE PEPTIDE II HUMAN GLP-2 GLP-2 (1-33) (HUMAN) GLP-2-ARG (HUMAN) TRIFLUOROACETATE SALT GLP-2 (HUMAN) PREPROGLUCAGON (126-159) (HUMAN) PREPROGLUCAGON (146-178) (HUMAN) PREPROGLUCAGON (146-179) (HUMAN) TRIFLUOROACETATE SALT glp-2-arg glucagon-like peptide 2 -arg human trifluoroacetate salt Glucagon-Like Peptide II, human HADGSFSDEMNTILDNLAARDFINWLIQTKITDR GLP-2 (1-34) Glucagon-Like Peptide 2 -Arg human trifluoroacetate salt >90% (HPLC), solid GLP-2 (HUMAN) USP/EP/BP 223460-79-5/89750-15-2 Glucagon-Like Peptide 2-Arg (human)/Preproglucagon (146-179) (human) /GLP-2 (HUMAN) HR-34 HADGSFSDEMNTILDNLAARDFINWLINTKITDR Glucagon-Like Peptide II, human|Peptide-2 (1-34) Glukagon like peptide 2 (human)trifluoroacetate salt 99120-49-7 C171H266N48O56S1 Other Protein/Peptide Hormones Hormones Cytokines, Growth Factors and Hormones Cell Biology Cell Signaling and Neuroscience BioChemical Peptide