Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> Calcitonin

Calcitonin

Calcitonin price.
  • $531 - $2563.6
  • Product name: Calcitonin
  • CAS: 9007-12-9
  • MF: C145H240N44O48S2
  • MW: 3431.85
  • EINECS:232-693-2
  • MDL Number:MFCD00133860
  • Synonyms:calcimar(salmon) ;calcitar ;calcitrin ;SALMON;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7)
19 prices
Selected condition:
Brand
  • Biorbyt Ltd
  • Usbiological
Package
  • 1mg
  • 5mg
  • 10mg
  • 100ul
  • 96Tests
  • ManufacturerBiorbyt Ltd
  • Product numberorb364460
  • Product descriptionCalcitonin > 95%
  • Packaging1mg
  • Price$691.9
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364460
  • Product descriptionCalcitonin > 95%
  • Packaging5mg
  • Price$1713.6
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364460
  • Product descriptionCalcitonin > 95%
  • Packaging10mg
  • Price$2563.6
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-29
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-24
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-27
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-23
  • Product descriptionCalcitonin
  • Packaging5mg
  • Price$691
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-26
  • Product descriptionCalcitonin
  • Packaging5mg
  • Price$691
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-28
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$701
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-16A-Biotin
  • Product descriptionCalcitonin
  • Packaging100ul
  • Price$1020
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-16A-FITC
  • Product descriptionCalcitonin
  • Packaging100ul
  • Price$1020
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-16A-AP
  • Product descriptionCalcitonin
  • Packaging100ul
  • Price$1020
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-16A-PE
  • Product descriptionCalcitonin
  • Packaging100ul
  • Price$1020
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-25
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$701
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-30
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$701
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-22
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$779
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Biorbyt Ltd orb364460 Calcitonin > 95% 1mg $691.9 2021-12-16 Buy
Biorbyt Ltd orb364460 Calcitonin > 95% 5mg $1713.6 2021-12-16 Buy
Biorbyt Ltd orb364460 Calcitonin > 95% 10mg $2563.6 2021-12-16 Buy
Usbiological C0115-29 Calcitonin 1mg $531 2021-12-16 Buy
Usbiological C0115-24 Calcitonin 1mg $531 2021-12-16 Buy
Usbiological C0115-27 Calcitonin 1mg $531 2021-12-16 Buy
Usbiological C0115-23 Calcitonin 5mg $691 2021-12-16 Buy
Usbiological C0115-26 Calcitonin 5mg $691 2021-12-16 Buy
Usbiological C0115-28 Calcitonin 1mg $701 2021-12-16 Buy
Usbiological C0115-16A-Biotin Calcitonin 100ul $1020 2021-12-16 Buy
Usbiological C0115-16A-FITC Calcitonin 100ul $1020 2021-12-16 Buy
Usbiological C0115-16A-AP Calcitonin 100ul $1020 2021-12-16 Buy
Usbiological C0115-16A-PE Calcitonin 100ul $1020 2021-12-16 Buy
Usbiological C0115-25 Calcitonin 1mg $701 2021-12-16 Buy
Usbiological C0115-30 Calcitonin 1mg $701 2021-12-16 Buy
Usbiological C0115-22 Calcitonin 1mg $779 2021-12-16 Buy

Properties

storage temp. :−20°C
solubility :0.05 M acetic acid: 1 mg/mL, clear, colorless
form :powder

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Calcitonin has been approved for the treatment of postmenopausal osteoporosis, hypercalcemia of malignancy, and Paget's disease of the bone.Several sources are available (e.g., eel, human, salmon, and porcine). The calcitonin isolated from salmon is the preferred source, because it has greater receptor affinity and a longer half-life than the human hormone.

More related product prices

Calcitonin salmon

Related product price