ChemicalBook Chinese Germany Japanese Korean

BOC Sciences Company Information

Company Name:    BOC Sciences
Tel:    -16314854226;
Email:    inquiry@bocsci.com
Nationality:    United States
WebSite:    https://www.bocsci.com/
Product List:    19743
170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198

Product List
Receptor tyrosine-protein kinase erbB-2 precursor (369-386)
Receptor tyrosine-protein kinase erbB-2 (689-697)
Retinal dehydrogenase 1 (88-96)
Ribosomal protein S26 (47-61)
Rho-related GTP-binding protein RhoC (176-185)
Receptor tyrosine-protein kinase erbB-2 (952-961)
Regulator of G-protein signaling 5 (74-83)
Rho guanine nucleotide exchange factor 17 (425-438)
Receptor tyrosine-protein kinase erbB-2 (754-762)
RER1 protein (80-91)
Regulator of G-protein signaling 5 (5-13)
Rhodopsin Epitope Tag
TAG-1 A2 (78-86)
Telomerase reverse transcriptase (461-469)
Survivin (80-88)
Telomerare Reverse Transcriptase (hTRT) (653-661)
Telomerase reverse transcriptase (672-686)
SYSMEHFRWGKPS
Telomerase reverse transcriptase (540-548)
Telomerase reverse transcriptase (865-873)
Telomerase Reverse Transcriptase (674-683)
TDSP5
TAMRA-β-Amyloid (1-42), human 1802087-80-4
SYT-SSX1 or -SSX2 fusion protein (402-410 (SYT))
Talin (777-785)
Telomerase reverse transcriptase (766-780)
TAG-2 (42-50)
Serine/threonine-protein kinase B-raf (586-614)
Serine protease hepsin (191-199)
Small nuclear ribonucleoprotein Sm D1 (11-19)
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Secernin-1 (196-204)
Structure-specific endonuclease subunit SLX4 (603-615)
Survivin (18-27)
Siyry 178561-37-0
Serine/threonine-protein kinase mTOR (89-98)
SSA protein SS-56 (55-64)
Secretin (5-27) (Porcine) 19665-15-7
Serine protease hepsin (268-276)
STh 118447-40-8
Sodium-coupled monocarboxylate transporter 2 (343-356)
Surface IgG (sA20-Ig) of A20 (106-114)
Serine protease hepsin (229-237)
St-Ht31 P 252869-81-1
Sperm surface protein Sp17 (103-111)
Sarcoma antigen 1 (715-723)
Small subunit processome component 20 homolog (626-634)
Survivin-3A (96-104)
Ribosome-binding protein 1 (879-887)
(S)-2-hydroxy-3-(2-methylphenyl)-propionic acid 458528-68-2
RPL8 protein (31-41)
(S)-2-hydroxy-3-(3-methylphenyl)-propionic acid 458528-71-7
Protein SSX2 (45-58)
Protein enabled homolog (443-451)
Protein SSX2 (41-49)
Protein SSX2 (101-111)
Prostatic acid phosphatase (18-26)
Protein SSX4 (151-170)
Protein SSX2 (45-59)
Prostatic acid phosphatase (112-120)
Protein SSX2 (37-54)
Protein SSX2 (19-34)
Protein OS-9 (438-446)
Protein enabled homolog (502-510)
Protein phosphatase 1 regulatory subunit 3B (172-180)
Prostatic acid phosphatase (299-307)
Rabenosyn-5 (541-552)
Putative protein product of HMFN1045 (253-264)
Receptor tyrosine-protein kinase erbB-2 (369-377)
Receptor tyrosine-protein kinase erbB-2 (654-662)
Receptor-type tyrosine-protein kinase FLT3 (591-600)
Protein SSX4 (31-50)
PSMA-PEG4 2256069-92-6
Receptor-type tyrosine-protein phosphatase kappa (667-682)
(R)-2-hydroxy-3-(2-methylphenyl)-propionic acid 1932808-80-4
(R)-2-hydroxy-3-(3-methylphenyl)-propionic acid 374119-33-2
PSMA (27-38)
Ras-related protein Rab-38 (50-58)
PSMA/PSM-P1 (4-12)
[pThr3]-CDK5 Substrate 1670273-47-8
Receptor tyrosine-protein kinase erbB-2 (1023-1032)
Receptor tyrosine-protein kinase erbB-2 (63-71)
Receptor tyrosine-protein kinase erbB-2 (391-399)
Protein timeless homolog (848-856)
Protein SSX4 (61-80)
Receptor tyrosine-protein kinase erbB-2 (466-474)
PSM P2 (711-719)
Protein SSX4 (51-70)
Protein SSX4 (41-60)
Ras-related protein Rab-27A (178-186)
Receptor tyrosine-protein kinase erbB-2 (435-443)
Receptor tyrosine-protein kinase erbB-2 (650-658)
Proto-oncogene PIM1 (191-199)
Receptor tyrosine-protein kinase erbB-2 (48-56)
Protein SSX4 (161-180)
[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor 1142-1153 141171-54-2
Receptor tyrosine-protein kinase erbB-2 (402-410)
Receptor tyrosine-protein kinase erbB-2 (5-13)
PSCA (14-22)
Receptor tyrosine-protein kinase erbB-2 (665-673)
170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198

Copyright 2007©  ChemicalBook. All rights reserved.