Identification | Back Directory | [Name]
BETA-AMYLOID (1-43) | [CAS]
134500-80-4 | [Synonyms]
A-BETA (1-43) β-Amyloid A4(1-43) BETA-AMYLOID (1-43) beta-Amyloid A4(1-43) β-Amyloid (1-43),human Amyloid β-Protein (1-43) AMyloid b-Protein (1-43) Amyloid β-Protein (1-42) BETA-AMYLOID (1-43) PEPTIDE AMYLOID BETA-PROTEIN (1-43) Amyloidb-Peptide(1-43)(human) BETA-AMYLOID (1-43) USP/EP/BP M.W. 4615.19 C207H318N56O62S amyloid β-protein fragment 1-43 amyloid B-protein fragment 1-43 Amyloid β-Peptide (1-43) (human) AMYLOID BETA-PROTEIN FRAGMENT 1-43 BETA-AMYLOID PEPTIDE [1-43], HUMAN AMYLOID BETA-PEPTIDE (1-43) (HUMAN) Amyloidβ-Protein(1-43)/β-Amyloid(1-43) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT H2N-D-A-E-F-R-H-D-S-G-Y-E-V-H-H-Q-K-L-V-F-F-A-E-D-V-G-S-N-K-G-A-I-I-G-L-M-V-G-G-V-V-I-A-T-OH H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-OH | [Molecular Formula]
C207H318N56O62S1 | [MDL Number]
MFCD00240623 | [Molecular Weight]
4615.14 |
Chemical Properties | Back Directory | [storage temp. ]
−20°C
| [solubility ]
Soluble in DMSO | [Sequence]
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-OH |
Hazard Information | Back Directory | [Uses]
β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use[1]. | [storage]
Store at -20°C | [References]
[1] Müller WE, et al., Effects of beta-amyloid peptides on the fluidity of membranes from frontal and parietal lobes of human brain. High potencies of A beta 1-42 and A beta 1-43. Amyloid. 1998;5(1):10-15. DOI:10.3109/13506129809007284 |
|
Company Name: |
|
Tel: |
821-50328103-801 18930552037 |
Website: |
https://www.chemicalbook.com/ShowSupplierProductsList13285/0.htm |
|