GLP-1 (7-37) | 106612-94-6

GLP-1 (7-37) Properties

Density	1.48±0.1 g/cm3(Predicted)
storage temp.	−20°C
solubility	Water:30.0(Max Conc. mg/mL);8.34(Max Conc. mM)
form	Lyophilized powder
color	White to off-white
Water Solubility	Soluble in water at 2mg/ml
Sequence	H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
CAS DataBase Reference	106612-94-6
FDA UNII	PI470C66NT

SAFETY

Risk and Safety Statements

Safety Statements	22-24/25
WGK Germany	3

GLP-1 (7-37) price More Price(13)

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Sigma-Aldrich	G9416	Glucagon-Like Peptide 1 Fragment 7-37 human ≥96% (HPLC)	106612-94-6	0.5mg	$530	2024-03-01	Buy
Alfa Aesar	J66232	Glucagon Like Peptide-1 (7-37)	106612-94-6	0.5mg	$191	2023-06-20	Buy
Alfa Aesar	J66232	Glucagon Like Peptide-1 (7-37)	106612-94-6	1mg	$364	2023-06-20	Buy
Tocris	5374	GLP-1(7-37)	106612-94-6	1	$458	2021-12-16	Buy
ChemScene	CS-5975	GLP-1(7-37) 99.87%	106612-94-6	5mg	$432	2021-12-16	Buy

Product number	Packaging	Price	Buy
G9416	0.5mg	$530	Buy
J66232	0.5mg	$191	Buy
J66232	1mg	$364	Buy
5374	1	$458	Buy
CS-5975	5mg	$432	Buy

GLP-1 (7-37) Chemical Properties,Uses,Production

Description

GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion. GLP-1 (7-37) and derivatives GLP-1 (9-37) and GLP-1 (28-37) can reduce plaque inflammation and increase phenotypic characteristics of plaque stability in a murine model of atherosclerosis.

Uses

Glucagon-Like Peptide 1 Fragment 7-37 human has been used:

as a positive control for insulin secretion of pancreatic islets
to test its effect on insulin response in horse islets
in combination with mesenchymal stem cells (MSCs) test its protective effects in myocardial infarction

General Description

Glucagon-Like Peptide 1 Fragment 7-37 human (GLP-1-(7-37)) is an amino-truncated form of GLP-1.

Biochem/physiol Actions

Glucagon-Like Peptide 1 Fragment 7-37 human (GLP-1-(7-37)) interacts with the GLP-1 receptor (GLP-1r). It mediates insulin release by stimulating the cyclic AMP accumulation in islet cells GLP-l(7-37) is a potential therapeutic agent due to its insulin-secretagogue functionality.

in vitro

In vitro, truncated glucagon-like peptides [GLP-1(7-36)-amide and GLP-1(7-37)] increase insulin secretion in a glucose-dependent manner, and desensitization to the action of GLP-1(7-37) has been demonstrated acutely with high concentrations.

in vivo

GLP-1(7-37) (0.5, 5 or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion in rats. Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM.

storage

Store at -20°C

GLP-1 (7-37) Preparation Products And Raw materials

Raw materials

Preparation Products

GLP-1 (7-37) Suppliers

Global( 187)Suppliers

Supplier	Tel	Email	Country	ProdList	Advantage
Cellmano Biotech Limited	0551-65326643 18156095617	info@cellmano.com	China	999	58
Nantong Guangyuan Chemicl Co,Ltd	+undefined17712220823	admin@guyunchem.com	China	615	58
Wuhan senwayer century chemical Co.,Ltd	+undefined-27-86652399 +undefined13627115097	market02@senwayer.com	China	902	58
Zibo Hangyu Biotechnology Development Co., Ltd	+86-0533-2185556 +8617865335152	Mandy@hangyubiotech.com	China	10986	58
Shanghai Getian Industrial Co., LTD	+86-15373193816 +86-15373193816	mike@ge-tian.com	China	269	58
Alpha Biopharmaceuticals Co., Ltd	+86-15542445688	sales@alabiochem.com	China	888	58
Henan Tianfu Chemical Co.,Ltd.	+86-0371-55170693 +86-19937530512	info@tianfuchem.com	China	21634	55
Hangzhou FandaChem Co.,Ltd.	+8615858145714	FandaChem@Gmail.com	China	9206	55
ATK CHEMICAL COMPANY LIMITED	+undefined-21-51877795	ivan@atkchemical.com	China	32957	60
career henan chemical co	+86-0371-86658258 +8613203830695	sales@coreychem.com	China	29881	58

Supplier	Advantage
Cellmano Biotech Limited	58
Nantong Guangyuan Chemicl Co,Ltd	58
Wuhan senwayer century chemical Co.,Ltd	58
Zibo Hangyu Biotechnology Development Co., Ltd	58
Shanghai Getian Industrial Co., LTD	58
Alpha Biopharmaceuticals Co., Ltd	58
Henan Tianfu Chemical Co.,Ltd.	55
Hangzhou FandaChem Co.,Ltd.	55
ATK CHEMICAL COMPANY LIMITED	60
career henan chemical co	58

View Lastest Price from GLP-1 (7-37) manufacturers

Update time	Product	Price	Min. Order	Purity	Supply Ability	Manufacturer
2024-09-25	GLP-1(7-37) 106612-94-6	US $0.00 / mg	10mg	99%	1000 boxes	Wuhan Senwayer Century Chemical Co.,Ltd
2024-08-27	GLP-1 (7-37) 106612-94-6	US $80.00-800.00 / kg	10kg	0.99	20tons	Zibo Hangyu Biotechnology Development Co., Ltd
2024-06-03	GLP-1 (7-37) 106612-94-6	US $28.00 / box	1box	99%	20000box	Shanghai Getian Industrial Co., LTD

GLP-1(7-37)
106612-94-6
US $0.00 / mg
99%
Wuhan Senwayer Century Chemical Co.,Ltd

GLP-1 (7-37)
106612-94-6
US $80.00-800.00 / kg
0.99
Zibo Hangyu Biotechnology Development Co., Ltd

GLP-1 (7-37)
106612-94-6
US $28.00 / box
99%
Shanghai Getian Industrial Co., LTD

106612-94-6(GLP-1 (7-37))Related Search:

Growth hormone releasing peptide Pralmorelin Sermorelin Nesiritide acetate Thymopentin

Triptorelin acetate Pramlintide acetate Eptifibatide Thymalfasin Glucagon

GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN GLP-2（Glucagon-like peptide-2） GLP-1（Glucagon-like peptide-1）(7-36) GLP-1 (7-37) GLP-1 (9-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, PORCINE, RAT)

AC-LEU-VAL-LYS-ALDEHYDE GLP-1+ FITC（Glucagon-like peptide-1）(7-36) ([125I]-TYR)-GLP-1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT)

1of4

Insulinotropin (human) Peptide GLP-1 (human glucose-lowering peptide-1) Glp-I (7-37) Glucagon like peptide I (7-37) Glucagon-related peptide (oncorhynchus kisutch), 3-L-glutamic acid-6-L-phenylalanine-9-L-aspartic acid-12-L-serine-15-L-glutamic acid-16-glycine-21-L-isoleucine-24-L-alanine-27-L-valine-28-L-lysine-31-glycine- Tglp-1 GLP-1, 7-37 Preproglucagon 78-108 GLP-1 (7-37) (huMan, bovine, guinea pig, Mouse, rat) Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Preproglucag 7-37-Glucagon-like peptide I (human) Human GLP-1 (7-37) insulinotropin GLP-1, 7-37, Preproglucagon 78-108 Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-128) (huMan, bovine, guinea pig, Mouse, rat) Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-128) (huMan, bovine, guinea pig, Mouse, rat) HuMan GLP-1 7-37-Glucagon-likepeptide H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH acetate salt GLP-1 (7-37) Acetate | Glucagon-Like Peptide 1 l-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alany PROGLUCAGON (78-108) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) PREPROGLUCAGON 78-108 HUMAN PREPROGLUCAGON (98-128) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) INSULINOTROPIN (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG GLP-1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG) GLP-1 (7-37) (HUMAN) GLP-1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLUCAGON-LIKE PEPTIDE 1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG) GLUCAGON LIKE PEPTIDE-I (7-37), HUMAN GLUCAGON-LIKE PEPTIDE 1, FRAGMENT 7-37 HUMAN GLUCAGON-LIKE PEPTIDE 1 (7-37) GLUCAGON-LIKE PEPTIDE 1 (7-37) (HUMAN) GLUCAGON-LIKE PEPTIDE 1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLP-1(7-38), Insulinotropin Glucagon-Like Peptide (GLP) I (7-37) GLP-1(7-37), >98% GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, >98% GLP-1(7-37) impurity H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH USP/EP/BP H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GL... TIANFUCHEM--106612-94-6---H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR- LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-LE-ALA-TRP-LEU-VAL- LYS-GLY-ARG-GLY-OH H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH Insulinotropin acetate [GLP-1 (7-37) GLP-1 acetate salt Glucagon-Like Peptide-1 (7-37)|GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) (5S,11S,14S,17S,20S,23S,26S,29S,32S,35S,38S,41S,44S,50S,53S,56S,59S,62S,65S,68S,71S,74S,77S,80S,86S)-20-((1H-Indol-3-yl)methyl)-86-((S)-2-((S)-2-amino-3-(1H-imidazol-5-yl)propanamido)propanamido)-44-(3-amino-3-oxopropyl)-11,35-bis(4-aminobutyl)-29,77-dibenzyl-26-((S)-sec-butyl)-32,50-bis(2-carboxyethyl)-68-(carboxymethyl)-5-(3-guanidinopropyl)-56-(4-hydroxybenzyl)-74,80-bis((R)-1-hydroxyethyl)-59,62,71-tris(hydroxymethyl)-17,53-diisobutyl-14,65-diisopropyl-23,38,41-trimethyl-4,7,10,13,16,19,22,2 106612-94-6 C151H228N40O47 peptides pharm peptide