ChemicalBook >> CAS DataBase List >>(D-Ala2)-Gastric Inhibitory Polypeptide (human)

(D-Ala2)-Gastric Inhibitory Polypeptide (human)

(D-Ala2)-Gastric Inhibitory Polypeptide (human) structure

CAS No.: 444073-04-5

Chemical Name:: (D-Ala2)-Gastric Inhibitory Polypeptide (human)

Synonyms: [D-Ala2]-GIP (human);Y（D-A）EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;(D-Ala2)-Gastric Inhibitory Polypeptide (human);(D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA;(D-Ala?)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt

CBNumber:: CB63864308

Molecular Formula:: C22H27NO11

Molecular Weight:: 481.44988

MDL Number:

MOL File:: 444073-04-5.mol

Last updated:2024-07-02 08:55:14

Request For Quotation

(D-Ala2)-Gastric Inhibitory Polypeptide (human) Properties

storage temp.	Store at -20°C
solubility	Soluble in DMSO
form	Solid
color	White to off-white
Water Solubility	Soluble to 1 mg/ml in water

(D-Ala2)-Gastric Inhibitory Polypeptide (human) price

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Tocris	6699	[D-Ala2]-GIP(human)	444073-04-5	1	$381	2021-12-16	Buy

Product number	Packaging	Price	Buy
6699	1	$381	Buy

(D-Ala2)-Gastric Inhibitory Polypeptide (human) Chemical Properties,Uses,Production

storage

Store at -20°C

(D-Ala2)-Gastric Inhibitory Polypeptide (human) Preparation Products And Raw materials

Raw materials

Preparation Products

(D-Ala2)-Gastric Inhibitory Polypeptide (human) Suppliers

Global( 22)Suppliers

Supplier	Tel	Email	Country	ProdList	Advantage
Shenzhen Nexconn Pharmatechs Ltd	+86-755-89396905 +86-15013857715	admin@nexconn.com	China	10312	58
Nanjing TGpeptide	+86-13347807150 +86-13347807150	support@tgpeptide.com	China	3279	58
Zhejiang Hangyu API Co., Ltd	+8617531972939	anna@api-made.com	China	2944	58
Aladdin Scientific	+1-+1(833)-552-7181	sales@aladdinsci.com	United States	52927	58
Chengdu Youngshe Chemical Co., Ltd.	+86-17380623303 +86-17380623303	Caroline@youngshechem.com	China	4887	58
Hangzhou Peptidego Biotech Co.,Ltd.	0571-87213919	eric@peptidego.com	China	6526	58
Nanjing TGpeptide Biotechnology Co.,Ltd.	18115476705	sales@tgpeptide.com	China	3058	58
Hangzhou Go Top Peptide Biotech	0571-88211921 13355716090	Sales@gotopbio.com	China	2849	58
Shaoxing Junyu Biotechnology Co., LTD	0571-88211921 15572296305	sales4@gotopbio.com	China	5145	58
Hangzhou Sinoda Pharmaceutical Technology Co. LTD	0571-87213919 17306812703	3007955328@qq.com	China	6213	58

Supplier	Advantage
Shenzhen Nexconn Pharmatechs Ltd	58
Nanjing TGpeptide	58
Zhejiang Hangyu API Co., Ltd	58
Aladdin Scientific	58
Chengdu Youngshe Chemical Co., Ltd.	58
Hangzhou Peptidego Biotech Co.,Ltd.	58
Nanjing TGpeptide Biotechnology Co.,Ltd.	58
Hangzhou Go Top Peptide Biotech	58
Shaoxing Junyu Biotechnology Co., LTD	58
Hangzhou Sinoda Pharmaceutical Technology Co. LTD	58

(D-Ala2)-Gastric Inhibitory Polypeptide (human) [D-Ala2]-GIP (human) (D-Ala?)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt Y（D-A）EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA 444073-04-5