ChemicalBook >> CAS DataBase List >>PACAP 1-27

PACAP 1-27

CAS No.
127317-03-7
Chemical Name:
PACAP 1-27
Synonyms
ovine;M-PACAP;PACAP-27;PACAP 1-27;PACAP-27 (human;PACAP (1-27) AMIDE;Human PACAP-(1-27);PACAP (1-27) (human;PACAP 27 AMIDE, OVINE;neurohypophysical hormone
CBNumber:
CB7101106
Molecular Formula:
C142H224N40O39S
Molecular Weight:
3147.61
MDL Number:
MFCD00167418
MOL File:
127317-03-7.mol
Last updated:2025-01-27 09:38:02

PACAP 1-27 Properties

Density 1.45±0.1 g/cm3(Predicted)
storage temp. −20°C
solubility 5% acetic acid: 1mg/mL
form solid
color white
Water Solubility Soluble to 1 mg/ml in water
InChIKey RZGBUJXSKLDAFE-XVTUQGJWNA-N
UNSPSC Code 12352202
NACRES NA.77

SAFETY

Risk and Safety Statements

WGK Germany  3

PACAP 1-27 price More Price(14)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich 05-23-2151 PACAP 27 Amide, Ovine Increases cAMP levels in a dose-dependent manner (EC?? = 4.7 nM). 127317-03-7 0.5MG $405 2024-03-01 Buy
Sigma-Aldrich 05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Increases cAMP levels in a dose-dependent manner (EC?? = 4.7 nM). 127317-03-7 .5mg $390 2023-01-07 Buy
Alfa Aesar J66752 PACAP (1-27), human, ovine, rat 127317-03-7 1mg $428 2023-06-20 Buy
Alfa Aesar J66752 PACAP (1-27), human, ovine, rat 127317-03-7 0.5mg $200 2021-12-16 Buy
Tocris 1183 PACAP1-27 127317-03-7 100U $161 2021-12-16 Buy
Product number Packaging Price Buy
05-23-2151 0.5MG $405 Buy
05-23-2151 .5mg $390 Buy
J66752 1mg $428 Buy
J66752 0.5mg $200 Buy
1183 100U $161 Buy

PACAP 1-27 Chemical Properties,Uses,Production

Uses

Pituitary Adenylate Cyclase-Activating Polypeptide 1-27 (PACAP 1-27) is a neuropeptide that stimulates adenylyl cyclase.

Biological Functions

PACAP 1-27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 functions in the control of anterior pituitary hormone secretion, vasodilation, adrenaline secretion, insulin secretion and immunosuppression.

Biological Activity

PACAP 1-27, also known as PACAP 27 Amide, is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). Potently stimulates adenylyl cyclase.

storage

Store at -20°C

PACAP 1-27 Preparation Products And Raw materials

Raw materials

Preparation Products

PACAP 1-27 Suppliers

Global( 124)Suppliers
Supplier Tel Email Country ProdList Advantage
Shanghai Getian Industrial Co., LTD
+86-15373193816 +86-15373193816 mike@ge-tian.com China 269 58
Hubei Jusheng Technology Co.,Ltd.
18871490254 linda@hubeijusheng.com CHINA 28172 58
BOC Sciences
+1-631-485-4226 inquiry@bocsci.com United States 19552 58
Beijing Yibai Biotechnology Co., Ltd
0086-182-6772-3597 sales04@yibaibiotech.com CHINA 419 58
Chongqing Chemdad Co., Ltd
+86-023-6139-8061 +86-86-13650506873 sales@chemdad.com China 39894 58
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 995 58
career henan chemical co
+86-0371-86658258 +8613203830695 factory@coreychem.com China 29809 58
Dideu Industries Group Limited
+86-29-89586680 +86-15129568250 1026@dideu.com China 22787 58
Baoji Guokang Bio-Technology Co., Ltd.
0917-3909592 13892490616 gksales1@gk-bio.com China 9307 58
Baoji Guokang Healthchem co.,ltd
+8615604608665 15604608665 dominicguo@gk-bio.com CHINA 9414 58

View Lastest Price from PACAP 1-27 manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
PACAP 1-27 pictures 2025-03-12 PACAP 1-27
127317-03-7
US $0.00-0.00 / g 1g 98 1000 Wuhan Circle Star Chem-medical Technology Co.,Ltd
PACAP 1-27 pictures 2024-05-15 PACAP 1-27
127317-03-7
US $23.00-17.00 / box 1box 99% 100000box Shanghai Getian Industrial Co., LTD
127317-03-7 pictures 2021-07-13 127317-03-7
127317-03-7
US $15.00-10.00 / KG 1KG 99%+ HPLC Monthly supply of 1 ton Zhuozhou Wenxi import and Export Co., Ltd
  • PACAP 1-27 pictures
  • PACAP 1-27
    127317-03-7
  • US $0.00-0.00 / g
  • 98
  • Wuhan Circle Star Chem-medical Technology Co.,Ltd
  • PACAP 1-27 pictures
  • PACAP 1-27
    127317-03-7
  • US $23.00-17.00 / box
  • 99%
  • Shanghai Getian Industrial Co., LTD
  • 127317-03-7 pictures
  • 127317-03-7
    127317-03-7
  • US $15.00-10.00 / KG
  • 99%+ HPLC
  • Zhuozhou Wenxi import and Export Co., Ltd
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 [ARG14,20,21, LEU16] PACAP (1-27), HUMAN, OVINE, RAT [ARG14,20,21, LEU16] PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (1-27), HUMAN, OVINE, RAT ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-27 OVINE ADENYLATE CYCLASE ACTIVATING PEPTIDE-27 pituitary adenylate cyclase activating*polypeptid pituitary adenylate cyclase activating polypeptide-27 ovine powdered posterior pitultary HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-ARG-GLN-LEU-ALA-VAL-ARG-ARG-TYR-LEU-ALA-ALA-VAL-LEU-NH2 HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 PACAP-38 (1-27) aMide (huMan, Mouse, ovine, porcine, rat), Pituitary Adenylate Cyclase Activating Polypeptide-27 (huMan, Mouse, ovine, porcine, rat) PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE 27 AMIDE, OVINE PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-27 (HUMAN, MOUSE, OVINE, PORCINE, RAT) PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE PITUITARY ADENYLATE CYCLASE-ACTIVATING POLYPEPTIDE 1-27 PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (1-27) AMIDE (HUMAN, OVINE, RAT) PITUARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE 27 (HUMAN, 1-27 AMIDE) OVINE, RAT PITUITARY ADENYLATE CYCLASE-ACTIVATING PEPTIDE (1-27) PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (1-27), HUMAN, OVINE, RAT PACAP-27 PACAP-38 (1-27) AMIDE (HUMAN, MOUSE, OVINE, PORCINE, RAT) PACAP 27 AMIDE, OVINE PACAP27 (HUMAN, 1-27 AMIDE) (OVINE, RAT) PACAP-27 (HUMAN, OVINE, RAT) PACAP 1-27 PACAP (1-27) AMIDE PACAP (1-27), AMIDE, HUMAN, OVINE, RAT PACAP (1-27), HUMAN, OVINE, RAT PACAP (1-27) (HUMAN, SHEEP, RAT) PACAP-PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (HUMAN, OVINE, RAT) M-PACAP PACAP-27 (HUMAN, MOUSE, OVINE, PORCINE, RAT) PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem L-Leucinamide, L-histidyl-L-seryl-L-α-aspartylglycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-α-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl- Pituitary adenylatecyclase-activating peptide-27 (human) (9CI) H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 USP/EP/BP ovine PACAP-27 (human porcine rat) trifluoroacetate salt Human PACAP-(1-27) neurohypophysical hormone PACAP (1-27) (human Pacpa-27 (human, mouse, ovine, porcine, rat) PACAP (1-27), amide, human, ovine, rat - 0.5 mg 127317-03-7 C43H66O12N12S2 C142H224N40O39S Cyclic Nucleotide Metabolism G Proteins and Cyclic Nucleotides Cell Biology Cell Signaling and Neuroscience BioChemical Adenylyl Cyclase Activators Peptide VIP and PACAP receptor