ChemicalBook > Product Catalog >Biochemical Engineering >Inhibitors >Proteases >CJC1295

CJC1295

CJC1295 Structure
CAS No.
863288-34-0
Chemical Name:
CJC1295
Synonyms
CJC-1295 Acetate;CJC1295;CJC Dac;CJC NO DAC;CJC1295 DCA;CJC-1295(2MG);sarms CJC1295;CJC-1295(10mg);CJC 1295 w/o DAC;CJC-1295 CJC-1295
CBNumber:
CB01470921
Molecular Formula:
C152H252N44O42
Molecular Weight:
3367.89688
MOL File:
863288-34-0.mol
MSDS File:
SDS
Modify Date:
2025/7/11 11:59:49

CJC1295 Properties

Melting point > 177° C (dec.)
Density 1.45
storage temp. -20°C Freezer, Under inert atmosphere
solubility Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
form Solid
color White to Off-White
InChIKey XOZMWINMZMMOBR-HRDSVTNWSA-N

SAFETY

Risk and Safety Statements

Symbol(GHS) 
GHS05
Signal word  Danger
Hazard statements  H314-H318
Precautionary statements  P280-P301+P330+P331-P302+P352-P304+P340-P305+P351+P338-P310

CJC1295 Chemical Properties,Uses,Production

Description

CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.

Uses

CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.

benefits

CJC1295 is a chemically synthesised peptide that significantly promotes the release of growth hormone by activating the pituitary gland. Receiving CJC-1295 peptide therapy has multiple benefits, including: increased metabolism and energy, decreased body fat and increased muscle mass, optimised immune system, improved bone density, improved sleep, shorter recovery time, repair of injuries, improved skin elasticity, reduced wrinkles, strengthened nails and hair, and more.

Pharmacology

By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.

Clinical Use

CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.

Side effects

CJC-1295 is safely biologically increased growth hormone levels without the side of effects of other medication such hGH treatment which have been none to have more side effects. Some of the side effects of CJC-1295 are generally mild and tend to not last long if at all such as headache, flushing, and dizziness. The most common reported side effect is redness and irritation at the injection site.

CJC1295 Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 177)Suppliers
Supplier Tel Country ProdList Advantage Inquiry
Balaji Smart Mobiles 08069013898Ext 228 Uttar Pradesh, India 2 58 Inquiry
Aliya Aquarium 08600290020 Maharashtra, India 3 58 Inquiry
Ronak Alkalies And Chemicals Private Limited 08048372180Ext 358 Gujarat, India 11 58 Inquiry
Pmay Ayurvedic Agency 08048371724Ext 499 Haryana, India 1 58 Inquiry
Hebei Xunou new energy Technology Co., LTD +86-17531957005; +undefined17531957005 China 36 58 Inquiry
Hubei KDG Web Science&Technology Co., Ltd 18672314556 +8618672314556 China 933 58 Inquiry
Shanghai Longyu Biotechnology Co., Ltd. +8619521488211 China 2556 58 Inquiry
Changzhou Xuanming Pharmaceutical Technology Co., Ltd. +86-519-85525359 +86-15995072465 China 604 58 Inquiry
Zhuzhou Yaozhijie Chemical Co., LTD +66-955486952 China 244 58 Inquiry
Hebei Jiafan Trading Company Limited +86-15354498258 China 133 58 Inquiry

Related articles

Related Qustion

CJC1295 Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide CJC-1295 CJC-1295 CJC1295 with out DAC -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl CJC-1295(2MG) CJC-1295(10mg) CJC-1295 Without DAC 86328-34-0 CJC-1295 Acetate without DAC Peptides Bodybuilding cjc-1295 Human Growth Peptide Cjc 1295 with Dac/Cjc 1295 Without Dac 2mg/Vials CJC1295 No DAC acetate CJC 1295 w/o DAC CJC1295 with DAC, MK677, Melanotan 2, huperzine A, minoxidil sulfate, RU58841, SAG CJC-1295 Acetate sarms CJC1295 CJC-1295 Whitout DAC/CJC-1295 DAC/CJC-1295 CJC1295 DCA CJC-1295(DAC/Without DAC) CJC Dac CJC-1295 without DAC 5mg + IPA 5mg Mazdutide Peptide CJC NO DAC CJC-1295+Ipamorelin 10mg (No DAC) (Peptide Blend) Mod GRF (1-29) 2mg (CJC-1295 no DAC) CJC-1295 withoud dac 15.CJC-1295 without dac CJC-1295 NO DAC raw material/5mg*10vials/10mg*10vials 863288-34-0 156-1-5 86328-34-0 C159H258N46O45 Peptides CJC 863288-34-0