ChemicalBook > Product Catalog >Biochemical Engineering >Inhibitors >Proteases >CJC1295

CJC1295

CAS No.: 863288-34-0

Chemical Name:: CJC1295

Synonyms: CJC-1295 Acetate;CJC1295;CJC1295 DCA;CJC-1295(2MG);sarms CJC1295;CJC-1295(10mg);CJC 1295 w/o DAC;CJC-1295 CJC-1295;CJC1295 with out DAC;CJC1295 No DAC acetate

CBNumber:: CB01470921

Molecular Formula:: C152H252N44O42

Molecular Weight:: 3367.89688

MOL File:: 863288-34-0.mol

MSDS File:: SDS

Modify Date:: 2024/6/27 18:15:55

Request For Quotation

CJC1295 Properties

Melting point	> 177° C (dec.)
Density	1.45
storage temp.	-20°C Freezer, Under inert atmosphere
solubility	Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
form	Solid
color	White to Off-White
InChIKey	XOZMWINMZMMOBR-HRDSVTNWSA-N

SAFETY

Risk and Safety Statements

Symbol(GHS)	GHS05
Signal word	Danger
Hazard statements	H314-H318
Precautionary statements	P280-P301+P330+P331-P302+P352-P304+P340-P305+P351+P338-P310

CJC1295 Chemical Properties,Uses,Production

Description

CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.

Uses

CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.

benefits

CJC1295 is a chemically synthesised peptide that significantly promotes the release of growth hormone by activating the pituitary gland. Receiving CJC-1295 peptide therapy has multiple benefits, including: increased metabolism and energy, decreased body fat and increased muscle mass, optimised immune system, improved bone density, improved sleep, shorter recovery time, repair of injuries, improved skin elasticity, reduced wrinkles, strengthened nails and hair, and more.

Pharmacology

By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.

Clinical Use

CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.

Side effects

CJC-1295 is safely biologically increased growth hormone levels without the side of effects of other medication such hGH treatment which have been none to have more side effects. Some of the side effects of CJC-1295 are generally mild and tend to not last long if at all such as headache, flushing, and dizziness. The most common reported side effect is redness and irritation at the injection site.

CJC1295 Preparation Products And Raw materials

Raw materials

Preparation Products

CJC1295 Suppliers

Global( 159)Suppliers

Supplier	Tel	Country	ProdList	Advantage	Inquiry
Balaji Smart Mobiles	08069013898Ext 228	Uttar Pradesh, India	2	58	Inquiry
Aliya Aquarium	08600290020	Maharashtra, India	3	58	Inquiry
Ronak Alkalies And Chemicals Private Limited	08048372180Ext 358	Gujarat, India	11	58	Inquiry
Pmay Ayurvedic Agency	08048371724Ext 499	Haryana, India	1	58	Inquiry
Hebei Xunou new energy Technology Co., LTD	+undefined17531957005	China	36	58	Inquiry
Changzhou Xuanming Pharmaceutical Technology Co., Ltd.	+8618068519287	China	833	58	Inquiry
Zhuzhou Yaozhijie Chemical Co., LTD	+8618073316972	China	244	58	Inquiry
Wuhan Godbullraw Chemical Co.,ltd	+undefined18986288449	China	560	58	Inquiry
Hubei Lange Biotechnology Co., Ltd.	+8617762501948	China	154	58	Inquiry
Wuhan Cell Pharmaceutical Co., Ltd	+86-13129979210 +86-13129979210	China	376	58	Inquiry

Supplier	Advantage
Balaji Smart Mobiles	58
Aliya Aquarium	58
Ronak Alkalies And Chemicals Private Limited	58
Pmay Ayurvedic Agency	58
Hebei Xunou new energy Technology Co., LTD	58
Changzhou Xuanming Pharmaceutical Technology Co., Ltd.	58
Zhuzhou Yaozhijie Chemical Co., LTD	58
Wuhan Godbullraw Chemical Co.,ltd	58
Hubei Lange Biotechnology Co., Ltd.	58
Wuhan Cell Pharmaceutical Co., Ltd	58

Mechanism and Benefits of CJC 1295-Ipamorelin
CJC 1295-Ipamorelin is version of a naturally occurring substance that causes release of growth hormone from the pituitary gla....
Aug 1，2022

863288-34-0(CJC1295)Related Search:

Pralmorelin Oxytocin Cetrorelix acetate motilin-related peptide Phosphorus trichloride

Trifluoroacetic acid Potassium pyrophosphate Dimethyl fumarate Cinnamaldehyde Sodium sulfide

L-Lysine BUSERELIN Melanotan II BPC 157 Melanotan 1

Ipamorelin Somatostatin Hexarelin

chevron_left

1of4

chevron_right

CJC1295 Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide CJC-1295 CJC-1295 CJC1295 with out DAC -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl CJC-1295(2MG) CJC-1295(10mg) CJC-1295 Without DAC 86328-34-0 CJC-1295 Acetate without DAC Peptides Bodybuilding cjc-1295 Human Growth Peptide Cjc 1295 with Dac/Cjc 1295 Without Dac 2mg/Vials CJC1295 No DAC acetate CJC 1295 w/o DAC CJC1295 with DAC, MK677, Melanotan 2, huperzine A, minoxidil sulfate, RU58841, SAG CJC-1295 Acetate sarms CJC1295 CJC-1295 Whitout DAC/CJC-1295 DAC/CJC-1295 CJC1295 DCA 863288-34-0 156-1-5 86328-34-0 C159H258N46O45 Peptides CJC 863288-34-0