ChemicalBook > Product Catalog >API >Fluid, Electrolyte, and Acid-Base Balance >Electrolyte Balance Pharmacology >Calcitonin eel

Calcitonin eel

Calcitonin eel Structure
CAS No.
57014-02-5
Chemical Name:
Calcitonin eel
Synonyms
ASU 1-7;miacalcic;Calcitoni;Eel calcitonin;CALCITONIN, EEL;Elcatonin impurity;THYROCALCITONIN EEL;Eel thyrocalcitonin;Calcitonin (eel) (9CI);Calcitonin eel USP/EP/BP
CBNumber:
CB8157135
Molecular Formula:
C146H241N43O47S2
Molecular Weight:
3414.91
MOL File:
57014-02-5.mol
Modify Date:
2023/11/14 17:13:14

Calcitonin eel Properties

Density 1.52±0.1 g/cm3(Predicted)
storage temp. −20°C
solubility Water: 10 mg/ml
form A solid

SAFETY

Risk and Safety Statements

WGK Germany  3

Calcitonin eel Chemical Properties,Uses,Production

Description

Calcitonin eel is a peptide hormone that lowers calcium concentration in the blood. In humans, it is released by thyroid cells and acts to decrease the formation and absorptive activity of osteoclasts. Its role in regulating plasma calcium is much greater in children and in certain diseases than in normal adults. Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.

Biological Activity

Calcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.

Calcitonin eel Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 140)Suppliers
Supplier Tel Country ProdList Advantage Inquiry
Hebei Yanxi Chemical Co., Ltd. +86-17531190177; +8617531190177 China 6011 58 Inquiry
Zibo Hangyu Biotechnology Development Co., Ltd +86-0533-2185556 +8617865335152 China 11027 58 Inquiry
Nantong Guangyuan Chemicl Co,Ltd +undefined17712220823 China 616 58 Inquiry
career henan chemical co +86-0371-86658258 +8613203830695 China 29901 58 Inquiry
Shenzhen Nexconn Pharmatechs Ltd +86-755-89396905 +86-15013857715 China 10259 58 Inquiry
BOC Sciences +1-631-485-4226 United States 19553 58 Inquiry
Cellmano Biotech Limited 0551-65326643 18156095617 China 999 58 Inquiry
Fuxin Pharmaceutical +86-021-021-50872116 +8613122107989 China 10297 58 Inquiry
SIMAGCHEM CORP +86-13806087780 China 17367 58 Inquiry
ANHUI WITOP BIOTECH CO., LTD +8615255079626 China 23556 58 Inquiry
THYROCALCITONIN EEL CALCITONIN, EEL CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7) H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7) cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7] miacalcic Thyrocalcitonin Eel, Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 [Disulfide bridge: 1-7] ASU 1-7 CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER- GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL- GLY-ALA-GLY-THR-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7) Eel calcitonin Eel thyrocalcitonin Calcitonin (eel) (9CI) Calcitonin, eel, ≥97% (HPLC) Calcitonin (salmon), 26-L-aspartic acid-27-L-valine-29-L-alanine- Elcatonin impurity Calcitonin eel USP/EP/BP ELCATONIN ACETATE 57014-02-5 Calcitoni 57014-02-5 C146H241N43O47S2 C146H243N43O47S2 Calcitonins Amino Acids and Peptides Biochemicals and Reagents BioChemical Peptides Thyroid Hormones Peptide TPI