PARATHYROID HORMONE (1-34), BOVINE
|
- $100 - $2480.3
- Product name: PARATHYROID HORMONE (1-34), BOVINE
- CAS: 12583-68-5
- MF: C183H288N54O50S2
- MW: 4108.71
- EINECS:200-001-8
- MDL Number:MFCD00147847
- Synonyms:ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE BOVINE;H-ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;BPTH 1-34;PTH (1-34) (BOVINE);TERIPARATIDE;PARATHYROID HORMONE (1-34), BOVINE
10 prices
Selected condition:
Brand
- Alfa Aesar
- ApexBio Technology
- Biorbyt Ltd
- Sigma-Aldrich
Package
- 0.1mg
- 0.5mg
- 1mg
- 5mg
- 10mg
- 25mg
- ManufacturerAlfa Aesar
- Product numberJ66200
- Product descriptionParathyroid Hormone (1-34), bovine
- Packaging0.5mg
- Price$162
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66200
- Product descriptionParathyroid Hormone (1-34), bovine
- Packaging1mg
- Price$272
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1114
- Product descriptionParathyroid Hormone (1-34), bovine
- Packaging1mg
- Price$100
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1114
- Product descriptionParathyroid Hormone (1-34), bovine
- Packaging5mg
- Price$300
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1114
- Product descriptionParathyroid Hormone (1-34), bovine
- Packaging10mg
- Price$500
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1114
- Product descriptionParathyroid Hormone (1-34), bovine
- Packaging25mg
- Price$700
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372676
- Product descriptionParathyroid Hormone (1-34) (Bovine) > 95%
- Packaging1mg
- Price$669.8
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372676
- Product descriptionParathyroid Hormone (1-34) (Bovine) > 95%
- Packaging5mg
- Price$1657.5
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372676
- Product descriptionParathyroid Hormone (1-34) (Bovine) > 95%
- Packaging10mg
- Price$2480.3
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberP3671
- Product descriptionParathyroid Hormone Fragment 1-34 bovine ≥97% (HPLC), powder
- Packaging0.1mg
- Price$166
- Updated2024-03-01
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
Alfa Aesar | J66200 | Parathyroid Hormone (1-34), bovine | 0.5mg | $162 | 2021-12-16 | Buy |
Alfa Aesar | J66200 | Parathyroid Hormone (1-34), bovine | 1mg | $272 | 2021-12-16 | Buy |
ApexBio Technology | A1114 | Parathyroid Hormone (1-34), bovine | 1mg | $100 | 2021-12-16 | Buy |
ApexBio Technology | A1114 | Parathyroid Hormone (1-34), bovine | 5mg | $300 | 2021-12-16 | Buy |
ApexBio Technology | A1114 | Parathyroid Hormone (1-34), bovine | 10mg | $500 | 2021-12-16 | Buy |
ApexBio Technology | A1114 | Parathyroid Hormone (1-34), bovine | 25mg | $700 | 2021-12-16 | Buy |
Biorbyt Ltd | orb372676 | Parathyroid Hormone (1-34) (Bovine) > 95% | 1mg | $669.8 | 2021-12-16 | Buy |
Biorbyt Ltd | orb372676 | Parathyroid Hormone (1-34) (Bovine) > 95% | 5mg | $1657.5 | 2021-12-16 | Buy |
Biorbyt Ltd | orb372676 | Parathyroid Hormone (1-34) (Bovine) > 95% | 10mg | $2480.3 | 2021-12-16 | Buy |
Sigma-Aldrich | P3671 | Parathyroid Hormone Fragment 1-34 bovine ≥97% (HPLC), powder | 0.1mg | $166 | 2024-03-01 | Buy |
Properties
storage temp. :−20°C
solubility :≥410.9 mg/mL in DMSO; ≥43.8 mg/mL in H2O; ≥64.6 mg/mL in EtOH
form :powder
color :White to off-white
solubility :≥410.9 mg/mL in DMSO; ≥43.8 mg/mL in H2O; ≥64.6 mg/mL in EtOH
form :powder
color :White to off-white
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
Parathyroid hormone (PTH) is an 84 amino acid hormone involved in calcium regulation in counteraction to calcitonin. PTH regulates serum phosphate levels and vitamin D biosynthesis. N-terminal peptides of PTH are used to elicit and study a wide variety of responses in target cells.Related product price
- 98614-76-7
$187-900 - PTH (1-84) (HUMAN)
$350-1800 - PTH (13-34) (HUMAN)
$125-643.5