Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> PARATHYROID HORMONE (1-34), BOVINE

PARATHYROID HORMONE (1-34), BOVINE

PARATHYROID HORMONE (1-34), BOVINE price.
  • $100 - $2480.3
  • Product name: PARATHYROID HORMONE (1-34), BOVINE
  • CAS: 12583-68-5
  • MF: C183H288N54O50S2
  • MW: 4108.71
  • EINECS:200-001-8
  • MDL Number:MFCD00147847
  • Synonyms:ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE BOVINE;H-ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;BPTH 1-34;PTH (1-34) (BOVINE);TERIPARATIDE;PARATHYROID HORMONE (1-34), BOVINE
10 prices
Selected condition:
Brand
  • Alfa Aesar
  • ApexBio Technology
  • Biorbyt Ltd
  • Sigma-Aldrich
Package
  • 0.1mg
  • 0.5mg
  • 1mg
  • 5mg
  • 10mg
  • 25mg
  • ManufacturerAlfa Aesar
  • Product numberJ66200
  • Product descriptionParathyroid Hormone (1-34), bovine
  • Packaging0.5mg
  • Price$162
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66200
  • Product descriptionParathyroid Hormone (1-34), bovine
  • Packaging1mg
  • Price$272
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1114
  • Product descriptionParathyroid Hormone (1-34), bovine
  • Packaging1mg
  • Price$100
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1114
  • Product descriptionParathyroid Hormone (1-34), bovine
  • Packaging5mg
  • Price$300
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1114
  • Product descriptionParathyroid Hormone (1-34), bovine
  • Packaging10mg
  • Price$500
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1114
  • Product descriptionParathyroid Hormone (1-34), bovine
  • Packaging25mg
  • Price$700
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372676
  • Product descriptionParathyroid Hormone (1-34) (Bovine) > 95%
  • Packaging1mg
  • Price$669.8
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372676
  • Product descriptionParathyroid Hormone (1-34) (Bovine) > 95%
  • Packaging5mg
  • Price$1657.5
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372676
  • Product descriptionParathyroid Hormone (1-34) (Bovine) > 95%
  • Packaging10mg
  • Price$2480.3
  • Updated2021-12-16
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberP3671
  • Product descriptionParathyroid Hormone Fragment 1-34 bovine ≥97% (HPLC), powder
  • Packaging0.1mg
  • Price$166
  • Updated2024-03-01
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Alfa Aesar J66200 Parathyroid Hormone (1-34), bovine 0.5mg $162 2021-12-16 Buy
Alfa Aesar J66200 Parathyroid Hormone (1-34), bovine 1mg $272 2021-12-16 Buy
ApexBio Technology A1114 Parathyroid Hormone (1-34), bovine 1mg $100 2021-12-16 Buy
ApexBio Technology A1114 Parathyroid Hormone (1-34), bovine 5mg $300 2021-12-16 Buy
ApexBio Technology A1114 Parathyroid Hormone (1-34), bovine 10mg $500 2021-12-16 Buy
ApexBio Technology A1114 Parathyroid Hormone (1-34), bovine 25mg $700 2021-12-16 Buy
Biorbyt Ltd orb372676 Parathyroid Hormone (1-34) (Bovine) > 95% 1mg $669.8 2021-12-16 Buy
Biorbyt Ltd orb372676 Parathyroid Hormone (1-34) (Bovine) > 95% 5mg $1657.5 2021-12-16 Buy
Biorbyt Ltd orb372676 Parathyroid Hormone (1-34) (Bovine) > 95% 10mg $2480.3 2021-12-16 Buy
Sigma-Aldrich P3671 Parathyroid Hormone Fragment 1-34 bovine ≥97% (HPLC), powder 0.1mg $166 2024-03-01 Buy

Properties

storage temp. :−20°C
solubility :≥410.9 mg/mL in DMSO; ≥43.8 mg/mL in H2O; ≥64.6 mg/mL in EtOH
form :powder
color :White to off-white

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Parathyroid hormone (PTH) is an 84 amino acid hormone involved in calcium regulation in counteraction to calcitonin. PTH regulates serum phosphate levels and vitamin D biosynthesis. N-terminal peptides of PTH are used to elicit and study a wide variety of responses in target cells. 

Related product price