ACTH (7-38) (HUMAN)
|
- $92.4 - $1866.6
- Product name: ACTH (7-38) (HUMAN)
- CAS: 68563-24-6
- MF: C167H257N47O46
- MW: 3659.11
- EINECS:
- MDL Number:MFCD00081282
- Synonyms:acth(7-38 ;FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE;H-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-OH;CORTICOTROPIN A;CORTICOTROPIN-LIKE INTERMEDIATE PEPTIDE HUMAN (7-38);CORTICOTROPIN-INHIBITING PEPTIDE;CORTICOTROPIN-INHIBITING PEPTIDE (HUMAN);CIP (HUMAN)
14 prices
Selected condition:
Brand
- Alfa Aesar
- Biorbyt Ltd
- Biosynth Carbosynth
- Sigma-Aldrich
- Usbiological
Package
- 250μg
- 0.5mg
- 500ug
- 1mg
- 2mg
- 5mg
- 10mg
- ManufacturerAlfa Aesar
- Product numberJ66765
- Product descriptionAdrenocorticotropic Hormone (7-38), human
- Packaging0.5mg
- Price$139
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66765
- Product descriptionAdrenocorticotropic Hormone (7-38), human
- Packaging1mg
- Price$209
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364165
- Product descriptionACTH (7-38) > 95%
- Packaging1mg
- Price$588.2
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364165
- Product descriptionACTH (7-38) > 95%
- Packaging5mg
- Price$1247.8
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364165
- Product descriptionACTH (7-38) > 95%
- Packaging10mg
- Price$1866.6
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging500ug
- Price$130
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging1mg
- Price$228
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging2mg
- Price$388
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging5mg
- Price$776
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging10mg
- Price$1349.6
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberA1527
- Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
- Packaging250μg
- Price$92.4
- Updated2024-03-01
- Buy
- ManufacturerSigma-Aldrich
- Product numberA1527
- Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
- Packaging0.5mg
- Price$145.2
- Updated2024-03-01
- Buy
- ManufacturerSigma-Aldrich
- Product numberA1527
- Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
- Packaging1mg
- Price$594
- Updated2024-03-01
- Buy
- ManufacturerUsbiological
- Product numberC7903-80F
- Product descriptionCorticotropin Inhibiting Peptide
- Packaging1mg
- Price$262
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
Alfa Aesar | J66765 | Adrenocorticotropic Hormone (7-38), human | 0.5mg | $139 | 2021-12-16 | Buy |
Alfa Aesar | J66765 | Adrenocorticotropic Hormone (7-38), human | 1mg | $209 | 2021-12-16 | Buy |
Biorbyt Ltd | orb364165 | ACTH (7-38) > 95% | 1mg | $588.2 | 2021-12-16 | Buy |
Biorbyt Ltd | orb364165 | ACTH (7-38) > 95% | 5mg | $1247.8 | 2021-12-16 | Buy |
Biorbyt Ltd | orb364165 | ACTH (7-38) > 95% | 10mg | $1866.6 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 500ug | $130 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 1mg | $228 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 2mg | $388 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 5mg | $776 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 10mg | $1349.6 | 2021-12-16 | Buy |
Sigma-Aldrich | A1527 | Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) | 250μg | $92.4 | 2024-03-01 | Buy |
Sigma-Aldrich | A1527 | Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) | 0.5mg | $145.2 | 2024-03-01 | Buy |
Sigma-Aldrich | A1527 | Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) | 1mg | $594 | 2024-03-01 | Buy |
Usbiological | C7903-80F | Corticotropin Inhibiting Peptide | 1mg | $262 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
form :Solid
color :White to off-white
Sequence :H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
form :Solid
color :White to off-white
Sequence :H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
Related product price
- Tosylmethyl isocyanide
$5-975 - TERT-BUTYL ISOCYANIDE
$22.4-550 - BENZYL ISOCYANIDE
$82-2194.5
Suppliers and manufacturers
Shenzhen Nexconn Pharmatechs Ltd
Cellmano Biotech Limited
Dideu Industries Group Limited
Hangzhou Go Top Peptide Biotech
Chengdu Youngshe Chemical Co., Ltd.
Nanjing TGpeptide
GL Biochem (Shanghai) Ltd
Shanghai Hanhong Scientific Co.,Ltd.