GIP (HUMAN)
![]() |
- $135 - $1620
- Product name: GIP (HUMAN)
- CAS: 100040-31-1
- MF: C226H338N60O66S
- MW: 4983.52932
- EINECS:
- MDL Number:MFCD00081634
- Synonyms:H-TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN-OH;GLUCOSE-DEPENDENT INSULINOTROPIC POLYPEPTIDE (HUMAN);GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);GIP (HUMAN);GIP;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN
8 prices
Selected condition:
Brand
- Alfa Aesar
- ApexBio Technology
- Sigma-Aldrich
- Tocris
Package
- 0.1mg
- .5mg
- 1
- 0.5mg
- 1mg
- .1mg
- ManufacturerAlfa Aesar
- Product numberJ66667
- Product descriptionGastric Inhibitory Peptide, human
- Packaging0.5mg
- Price$135
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66667
- Product descriptionGastric Inhibitory Peptide, human
- Packaging1mg
- Price$286
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5255
- Product descriptionGIP(human)
- Packaging1mg
- Price$520
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging.1mg
- Price$358
- Updated2022-05-15
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging0.1mg
- Price$404
- Updated2024-03-01
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging.5mg
- Price$1440
- Updated2022-05-15
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging0.5mg
- Price$1620
- Updated2024-03-01
- Buy
- ManufacturerTocris
- Product number2084
- Product descriptionGIP(human)
- Packaging1
- Price$458
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
Alfa Aesar | J66667 | Gastric Inhibitory Peptide, human | 0.5mg | $135 | 2021-12-16 | Buy |
Alfa Aesar | J66667 | Gastric Inhibitory Peptide, human | 1mg | $286 | 2021-12-16 | Buy |
ApexBio Technology | B5255 | GIP(human) | 1mg | $520 | 2021-12-16 | Buy |
Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | .1mg | $358 | 2022-05-15 | Buy |
Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | 0.1mg | $404 | 2024-03-01 | Buy |
Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | .5mg | $1440 | 2022-05-15 | Buy |
Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | 0.5mg | $1620 | 2024-03-01 | Buy |
Tocris | 2084 | GIP(human) | 1 | $458 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
form :Solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
form :Solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
GIP was originally isolated as a gastric inhibitory polypeptide. After the discovery of its glucose-dependent insulinotropic activity, known as the incretin effect, GIP was renamed glucose-dependent insulinotropic peptide.Gastric inhibitory peptide
Abbreviation: GIP
Additional names: gastric inhibitory polypeptide,gastrointestinal inhibitory peptide, glucose-dependent, insulinotropic peptide
Related product price
- 15522-69-7
$18.7-663 - N-BUTYLISOCYANIDE
$45-1028.41 - SALCOMINE
$6-4889.68
Suppliers and manufacturers
Alpha Biopharmaceuticals Co., Ltd
Shenzhen Nexconn Pharmatechs Ltd
BOC Sciences
Shanghai Longyu Biotechnology Co., Ltd.
Cellmano Biotech Limited
Zhejiang J&C Biological Technology Co.,Limited
Hangzhou Go Top Peptide Biotech
Alfa Chemistry