Parstatin (human)
- $352 - $692
- Product name: Parstatin (human)
- CAS: 1065755-99-8
- MF: C191H330N64O53S3
- MW: 0
- EINECS:
- MDL Number:
- Synonyms:Parstatin (human);MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR;Parstatin (human) TFA
3 prices
Selected condition:
Brand
- American Custom Chemicals Corporation
- ApexBio Technology
- Tocris
Package
- 1
- 1mg
- 5MG
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0004614
- Product descriptionPARSTATIN-HUMAN 95.00%
- Packaging5MG
- Price$504.42
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5450
- Product descriptionParstatin(human)
- Packaging1mg
- Price$692
- Updated2021-12-16
- Buy
- ManufacturerTocris
- Product number3553
- Product descriptionParstatin(human)
- Packaging1
- Price$352
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
American Custom Chemicals Corporation | PEP0004614 | PARSTATIN-HUMAN 95.00% | 5MG | $504.42 | 2021-12-16 | Buy |
ApexBio Technology | B5450 | Parstatin(human) | 1mg | $692 | 2021-12-16 | Buy |
Tocris | 3553 | Parstatin(human) | 1 | $352 | 2021-12-16 | Buy |
Properties
storage temp. :Store at -20°C
form :Powder
Water Solubility :Soluble to 1 mg/ml in water
form :Powder
Water Solubility :Soluble to 1 mg/ml in water
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50~ 3μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activityin vitro. Inhibits angiogenesis and exhibits cardioprotective activityin vivo.More related product prices
Parstatin (mouse)Related product price
- Parstatin (mouse)
$459-700