(AC-TYR1,D-PHE2)-GRF (1-29) AMIDE (HUMAN)

Information Error Report

Your Email:

Browse by province (AC-TYR1,D-PHE2)-GRF (1-29) AMIDE (HUMAN) Suppliers

Global suppliers

Beijing(1)	Zhejiang(2)	Member(13)	All(13)
Shanghai(7)	Jiangsu(3)

(AC-TYR1,D-PHE2)-GRF (1-29) AMIDE (HUMAN) Recommend Suppliers

Recommend You Select Member Companies...

Company Name:	3B Pharmachem (Wuhan) International Co.,Ltd.      Recommend    Complaint
Tel:	821-50328103-801
FAX:	86-21-50328109
Email:	3bsc@sina.com
Products Intro:	Product Name:[Ac-Tyr1,D-Phe2]GRF 1-29, aMide (huMan) Purity:99% HPLC Package:1Mg ; 5Mg;10Mg ;100Mg;250Mg ;500Mg ;1g;2.5g ;5g ;10g   More...
CB Index:	69
WebSite:	https://www.chemicalbook.com/ShowSupplierProductsList13285/0.htm
Related Information:	Sales Network   Catalog(15839)   User Evaluation(22)

Company Name:	GL Biochem (Shanghai) Ltd      Recommend    Complaint
Tel:	21-61263452
FAX:	86-21-61263399
Email:	ymbetter@glbiochem.com
Products Intro:	Product Name:VIP Antagonist;KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g   More...
CB Index:	64
WebSite:	www.glschina.com/
Related Information:	Sales Network   Catalog(9981)   User Evaluation(7)

Company Name:	Chemsky（shanghai）International Co.,Ltd.      Recommend    Complaint
Tel:	021-50135380
FAX:
Email:	shchemsky@sina.com
Products Intro:	Product Name:Ac-Tyr-D-Phe-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2;VIP Antagonist;[Ac-Tyr1, D-Phe2]GRF (1-29) aMide Purity:98%+   More...
CB Index:	50
WebSite:	www.shchemsky.com
Related Information:	Sales Network   Catalog(32321)   User Evaluation

Company Name:	Nanjing Peptide Biotech Ltd.      Recommend    Complaint
Tel:	025-025-58361106-805-805
FAX:	025-58361106-806
Email:	liugang@njpeptide.com
Products Intro:	Product Name:VIP Antagonist;KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC   More...
CB Index:	55
WebSite:	http://www.njpeptide.com
Related Information:	Sales Network   Catalog(9980)   User Evaluation

Company Name:	Hangzhou Peptidego Biotech Co.,Ltd.      Recommend    Complaint
Tel:	0571-87213919
FAX:	0571-87213919
Email:	Eric@peptidego.com
Products Intro:	Product Name:Ac-Tyr1,D-Phe2]GRF 1-29, amide (human); VIP Antagonist Purity:95% or 98% Package:1mg；5mg；10mg；50mg；100mg,1g or according to customer's detail requirement.   More...
CB Index:	58
WebSite:	http://www.peptidego.com
Related Information:	Sales Network   Catalog(6756)   User Evaluation

Company Name:	Nanjing Meihao Pharmaceutical Technology Co., Ltd.      Recommend    Complaint
Tel:	meitaochem@126.com
FAX:
Email:	meitaochem@126.com
Products Intro:	Product Name:VIP Antagonist; KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 Purity:99% HPLC Package:500g;1kg;5kg;25kg   More...
CB Index:	58
WebSite:	www.chemicalbook.com/ShowSupplierProductsList31244/0.htm
Related Information:	Sales Network   Catalog(19103)   User Evaluation

Company Name:	Nanjing Shizhou Biology Technology Co.,Ltd      Recommend    Complaint
Tel:
FAX:
Email:	alan.chow@synzest.com
Products Intro:	Product Name:Ac-[Tyr1,D-Phe2]-GRF(1-29) amide(human) Purity:95% HPLC Package:100mg;250mg;500mg;1g;5g Remarks:apnoke   More...
CB Index:	58
WebSite:	www.synzest.com
Related Information:	Sales Network   Catalog(9470)   User Evaluation

Company Name:	Hangzhou Sinoda Pharmaceutical Technology Co. LTD      Recommend    Complaint
Tel:	0571-87213919
FAX:
Email:	3007955328@qq.com
Products Intro:	Product Name:[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human); VIP Antagonist Purity:95% or 98% Package:1mg；5mg；10mg；50mg；100mg,1g or according to customer's detail requirement.   More...
CB Index:	58
WebSite:	www.chemicalbook.com/showsupplierproductslist1355681/0.htm
Related Information:	Sales Network   Catalog(6445)   User Evaluation

1 2