88813-36-9(GALANIN, PORCINE)

88813-36-9 Basic information More..

Product Name:	GALANIN, PORCINE
Synonyms:	GALANIN PORCINEGALANIN POR;H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-HIS-ASP-LYS-TYR-GLY-LEU-ALA-NH2;GALANIN (PIG);GALANIN, PORCINE;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-HIS-ASP-LYS-TYR-GLY-LEU-ALA-NH2;GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2;Ccris 6750;Galanin(1-29) porcine
CAS:	88813-36-9
MF:	C146H213N43O40
MW:	3210.52
EINECS:
Mol File:	Mol File

Information Error Report

Your Email:

Browse by Nationality 88813-36-9 Suppliers

France(1)	India(1)	United Kingdom(5)	Member(12)
Germany(3)	Switzerland(2)	United States(15)	All(27)

88813-36-9 Recommend Suppliers

Recommend You Select Member Companies.

Company Name:	BOC Sciences Recommend Complaint
Tel:
Email:	info@bocsci.com
Nationality:	USA
Products Intro:	Product Name:Galanin (porcine) CAS:88813-36-9 Remarks:Galanin (porcine) is an endogenous porcine galanin receptor agonist (pKi = 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at hGAL1, rGAL1, hGAL2, rGAL2, hGAL3 and rGAL3, respectively). It causes an increase in
CB Index:	65
WebSite:	https://www.bocsci.com
Related Information:	Sales Network Catalog() User Evaluation

Company Name:	BOC Sciences Recommend Complaint
Tel:	+1-631-485-4226
Email:	inquiry@bocsci.com
Nationality:	United States
Products Intro:	Product Name:Galanin (porcine) CAS:88813-36-9 Remarks:Reach out to us for more information about custom solutions.
CB Index:	58
WebSite:	www.bocsci.com/
Related Information:	Sales Network Catalog(19552) User Evaluation

Company Name:	ApexBio Technology Recommend Complaint
Tel:	+ 1-832-696-8203
Email:	sales@apexbt.com
Nationality:	United States
Products Intro:	Product Name:Galanin (porcine) CAS:88813-36-9
CB Index:	58
WebSite:	www.apexbt.com
Related Information:	Sales Network Catalog(6251) User Evaluation

Company Name:	Carbosynth Recommend Complaint
Tel:	+86 512 6260 5585
Email:	sales@carbosynth.com
Nationality:	United Kingdom
Products Intro:	Product Name:Galanin CAS:88813-36-9
CB Index:	58
WebSite:	www.carbosynth.com
Related Information:	Sales Network Catalog(6005) User Evaluation

Company Name:	United States Biological Recommend Complaint
Tel:	1-800-520-3011
Email:	sales@advtechind.com
Nationality:	United States
Products Intro:	Product Name:Galanin (porcine)
CB Index:	58
WebSite:	www.usbio.net
Related Information:	Sales Network Catalog(6075) User Evaluation

1 2 3

Tag: 88813-36-9

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.