Log in | Join Free | china | japan | germany

SNX-482

Request For Quotation
SNX-482 Suppliers list
Company Name: Hefei KS-V Peptide Biotechnology Co., Ltd.  
Tel: 0551-65120828 17368858770
Email: sales1@difficultpeptide.com
Products Intro: Product Name:SNX482
Purity:≥95%,1mg/5mg/10mg Package:1g/;1mg/
Company Name: Zhongke Huayao (Jiangsu) Biotechnology Co., Ltd  
Tel: 18014456767 18014456767
Email: wenxi@jszkhy.com
Products Intro: Product Name:203460-30-4
Purity:>=98% or 99% Remarks:500g
Company Name: United States Biological  
Tel: 1-800-520-3011
Email: sales@advtechind.com
Products Intro: Product Name:SNX 482
Company Name: United States Biological  
Tel: 800.520.3011 or 781.639.5092
Email: chemicals@usbio.net
Products Intro: Product Name:SNX 482
Company Name: Shanghai Silk Dragon Biological Technology Co., Ltd.  
Tel: 021-64221773
Email:
Products Intro: Product Name:SNX 482
SNX-482 Basic information
Product Name:SNX-482
Synonyms:GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD;GLY-VAL-ASP-LYS-ALA-GLY-CYS-ARG-TYR-MET-PHE-GLY-GLY-CYS-SER-VAL-ASN-ASP-ASP-CYS-CYS-PRO-ARG-LEU-GLY-CYS-HIS-SER-LEU-PHE-SER-TYR-CYS-ALA-TRP-ASP-LEU-THR-PHE-SER-ASP;SNX-482
CAS:
MF:
MW:0
EINECS:
Product Categories:Calcium Channel Modulators;Inhibitors and Activators;Voltage-gated Ion Channels
Mol File:Mol File
SNX-482 Structure
SNX-482 Chemical Properties
storage temp. −20°C
solubility aqueous buffer: soluble
form lyophilized powder
Safety Information
WGK Germany 3
MSDS Information
ProviderLanguage
SigmaAldrich English
SNX-482 Usage And Synthesis
SNX-482 Preparation Products And Raw materials
Tag:SNX-482 Related Product Information
CALCICLUDINE ω-conotoxin CVIA Protoxin ll MARGATOXIN ODK2 KURTOXIN ODK2 analogues μ-conotoxin GlllA SHK TOXIN OMEGA-AGATOXIN IVA SSD609 HUWENTOXIN IV mu-conotoxin PLTX-ll CALCISEPTINE ω-conotoxin MVllA Dendrotoxin-l ω-agatoxin IVB