GIP (3 - 42), human manufacturers
- GIP (3-42), human
-
- $196.00 / 1mg
-
2024-11-07
- CAS:1802086-25-4
- Min. Order:
- Purity:
- Supply Ability: 10g
|
| GIP (3 - 42), human Basic information |
Product Name: | GIP (3 - 42), human | Synonyms: | GIP (3 - 42), human;GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN;EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH;GIP (3-42), human - 1 mg | CAS: | 1802086-25-4 | MF: | | MW: | 0 | EINECS: | | Product Categories: | peptide | Mol File: | Mol File | ![GIP (3 - 42), human Structure]() |
| GIP (3 - 42), human Chemical Properties |
storage temp. | Store at -20°C | solubility | Soluble in DMSO | form | Solid | color | White to off-white |
| GIP (3 - 42), human Usage And Synthesis |
| GIP (3 - 42), human Preparation Products And Raw materials |
|