Log in | Join Free | china | japan | germany

[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat

Request For Quotation
[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat Suppliers list
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Products Intro: Product Name:[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat;YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2(Disulfidebridge:2-7)
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.  
Tel: meitaochem@126.com
Email: meitaochem@126.com
Products Intro: Product Name:[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat;YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2(Disulfidebridge:2-7)
Purity:99% HPLC Package:500g;1kg;5kg;25kg
Company Name: Advanced Technology & Industrial Co., Ltd.  
Tel: (852) 23902293
Email: sales@advtechind.com
Products Intro:
[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat Basic information
Product Name:[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat
Synonyms:[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat
CAS:
MF:
MW:0
EINECS:
Product Categories:peptide
Mol File:Mol File
[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat Structure
[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat Chemical Properties
Safety Information
MSDS Information
[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat Usage And Synthesis
[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat Preparation Products And Raw materials
Tag:[Tyr0]-α-Calcitonin Gene Related Peptide, [Tyr0]-α-CGRP, rat Related Product Information
Calcitonin