Company Name: |
GL Biochem (Shanghai) Ltd
|
Tel: |
21-61263452 13641803416 |
Email: |
ymbetter@glbiochem.com |
Products Intro: |
Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine;YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
|
Company Name: |
Wuxi Zhongkun Biochemical Technology Co., Ltd.
|
Tel: |
0510-85629785 18013409632 |
Email: |
sales@reading-chemicals.com |
Products Intro: |
Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Purity:95%+ Package:根据客户需求包装
|
Company Name: |
Hangzhou Peptidego Biotech Co.,Ltd.
|
Tel: |
0571-87213919 |
Email: |
eric@peptidego.com |
Products Intro: |
Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
|
Company Name: |
Nanjing Meihao Pharmaceutical Technology Co., Ltd.
|
Tel: |
meitaochem@126.com |
Email: |
meitaochem@126.com |
Products Intro: |
Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine; YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 Purity:99% HPLC Package:500g;1kg;5kg;25kg
|
|
| Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
Basic information |
Product Name: | Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
| Synonyms: | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2;Growth Hormone Releasing Factor, GRF (1-44), amide, bovine | CAS: | | MF: | | MW: | 0 | EINECS: | | Product Categories: | peptide | Mol File: | Mol File | ![Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
Structure]() |
| Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
Chemical Properties |
| Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
Usage And Synthesis |
| Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
Preparation Products And Raw materials |
|