Log in | Join Free | china | japan | germany

[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine

Request For Quotation
[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine Suppliers list
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Products Intro: Product Name:[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine;YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.  
Tel: meitaochem@126.com
Email: meitaochem@126.com
Products Intro: Product Name:[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine;YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Purity:99% HPLC Package:500g;1kg;5kg;25kg
Company Name: AnaSpec, Inc.  
Tel: 800 452 5530
Email: service@anaspec.com
Products Intro:
Company Name: Advanced Technology & Industrial Co., Ltd.  
Tel: (852) 23902293
Email: sales@advtechind.com
Products Intro:
[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine Basic information
Product Name:[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine
Synonyms:[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine
CAS:
MF:
MW:0
EINECS:
Product Categories:peptide
Mol File:Mol File
[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine Structure
[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine Chemical Properties
Safety Information
MSDS Information
[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine Usage And Synthesis
[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine Preparation Products And Raw materials
Tag:[Tyr0]-Corticotropin Releasing Factor, [Tyr0]-CRF, ovine Related Product Information
CRF (OVINE)