| Company Name: |
Creative Peptides
|
| Tel: |
|
| Email: |
info@creative-peptides.com |
| Products Intro: |
Product Name:Obtustatin
Purity:>98% Package:1g; 10g;100g;1kg Remarks:Peptide Inhibitors
|
|
| | Obtustatin Basic information |
| Product Name: | Obtustatin | | Synonyms: | CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG(MODIFICATIONS: DISULFIDE BRIDGE: 1-10,6-29,7-34,19-36);Obtustatin | | CAS: | 404882-00-4 | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | | | Mol File: | Mol File | ![Obtustatin Structure]() |
| | Obtustatin Chemical Properties |
| form | Solid | | color | White to off-white |
| | Obtustatin Usage And Synthesis |
| Enzyme inhibitor | This 41-residue disintegrin (FW = 4401 g/mol; Sequence CTTGPCCRQ CKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG, with disulfide bonds at Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, and Cys19-Cys36) from the venom of the blunt-nosed viper Vipera lebetina obtusa exhibits tight binding to integrins, inhibiting platelet aggregation, IC50 = 2 nM. It is the shortest polypeptide to contain an integrin-recognition loop. Target(s): Obtustatin is a highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen), displaying specificity for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7. |
| | Obtustatin Preparation Products And Raw materials |
|