| Company Name: |
GL Biochem (Shanghai) Ltd
|
| Tel: |
21-61263452 13641803416 |
| Email: |
ymbetter@glbiochem.com |
| Products Intro: |
Product Name:PEP1;SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
|
| Company Name: |
Chengdu Youngshe Chemical Co., Ltd.
|
| Tel: |
+86-17380623303 +86-17380623303 |
| Email: |
Caroline@youngshechem.com |
| Products Intro: |
Product Name:Pep-1
Purity:95% Package:1G; 10G; 100G
|
| Company Name: |
Hangzhou Peptidego Biotech Co.,Ltd.
|
| Tel: |
0571-87213919 |
| Email: |
Eric@peptidego.com |
| Products Intro: |
Product Name:PEP1
Purity:95% or 98% HPLC Package:1mg；5mg；10mg；50mg；100mg,1g or according to customer's detail requirement.
|
|
| Product Name: | PEP-1 | | Synonyms: | Anti-Nsg1 (N-terminal) antibody produced in goat;PEP-1;SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2;SER-GLY-SER-TRP-LEU-ARG-ASP-VAL-TRP-ASP-TRP-ILE-CYS-THR-VAL-LEU-THR-ASP-PHE-LYS-THR-TRP-LEU-GLN-SER-LYS-LEU-ASP-TYR-LYS-ASP-NH2;H-Lys-Glu-Thr-Trp-Trp-Glu-Thr-Trp-Trp-Thr-Glu-Trp-Ser-Gln-Pro-Lys-Lys-Lys-Arg-Lys-Val-OH;LYS-GLU-THR-TRP-TRP-GLU-THR-TRP-TRP-THR-GLU-TRP-SER-GLN-PRO-LYS-LYS-LYS-ARG-LYS-VAL: KETWWETWWTEWSQPKKKRKV;neuron specific gene family member 1;brain neuron cytoplasmic protein 1/2 | | CAS: | | | MF: | C177H259N43O49S | | MW: | 3805.27 | | EINECS: | | | Product Categories: | Peptide | | Mol File: | Mol File |  |
| | PEP-1 Chemical Properties |
| | PEP-1 Usage And Synthesis |
| | PEP-1 Preparation Products And Raw materials |
|