Company Name: |
GL Biochem (Shanghai) Ltd
|
Tel: |
21-61263452 13641803416 |
Email: |
ymbetter@glbiochem.com |
Products Intro: |
Product Name:Cerebral peptide 2;FDFGFAGLDTYDAIHRALEQPARGTSNSGSGYNMLMKMQRH-NH2 Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
|
|
| cerebral peptide 2 Basic information |
Product Name: | cerebral peptide 2 | Synonyms: | cerebral peptide 2;FDFGFAGLDTYDAIHRALEQPARGTSNSGSGYNMLMKMQRH-NH2 | CAS: | | MF: | | MW: | 0 | EINECS: | | Product Categories: | peptide | Mol File: | Mol File | |
| cerebral peptide 2 Chemical Properties |
| cerebral peptide 2 Usage And Synthesis |
| cerebral peptide 2 Preparation Products And Raw materials |
|