Company Name: |
GL Biochem (Shanghai) Ltd
|
Tel: |
21-61263452 13641803416 |
Email: |
ymbetter@glbiochem.com |
Products Intro: |
Product Name:[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g
|
Company Name: |
Nanjing Peptide Biotech Ltd.
|
Tel: |
025-025-58361106-805-805 13082558573 |
Email: |
liugang@njpeptide.com |
Products Intro: |
Product Name:[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC
|
Company Name: |
Hangzhou Peptidego Biotech Co.,Ltd.
|
Tel: |
0571-87213919 |
Email: |
Eric@peptidego.com |
Products Intro: |
Product Name:Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2;His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Arg-Gln-Leu-Ala-Val-Arg-Arg-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-Gly-Lys-Arg-NH2 Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
|
Company Name: |
Hangzhou Sinoda Pharmaceutical Technology Co. LTD
|
Tel: |
0571-87213919 17306812703 |
Email: |
3007955328@qq.com |
Products Intro: |
Product Name:[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2;His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Arg-Gln-Leu-Ala-Val-Arg-Arg-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-Gly-Lys-Arg-NH2 Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
|
|
Product Name: | BM-VIP | Synonyms: | [ARG15,20,21, LEU17] VASOACTIVE INTESTINAL PEPTIDE-GLY-LYS-ARG-NH2;[ARG15,20,21, LEU17] VIP-GLY-LYS-ARG-NH2;BM-VIP;HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-ARG-GLN-LEU-ALA-VAL-ARG-ARG-TYR-LEU-ASN-SER-ILE-LEU-ASN-GLY-LYS-ARG-NH2: HSDAVFTDNYTRLRRQLAVRRYLNSILNGKR-NH2;His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Arg-Gln-Leu-Ala-Val-Arg-Arg-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-Gly-Lys-Arg-NH2 | CAS: | 186844-13-3 | MF: | | MW: | 0 | EINECS: | | Product Categories: | | Mol File: | Mol File | |
| BM-VIP Chemical Properties |
| BM-VIP Usage And Synthesis |
| BM-VIP Preparation Products And Raw materials |
|