Sign in | Register | china | japan | germany

barbourin

Request For Quotation
barbourin Basic information
Product Name:barbourin
Synonyms:barbourin
CAS:135402-55-0
MF:
MW:0
EINECS:
Product Categories:
Mol File:Mol File
barbourin Structure
barbourin Chemical Properties
Safety Information
MSDS Information
barbourin Usage And Synthesis
Enzyme inhibitorThis platelet aggregation activation inhibitor (MW = 7700.52 g/mol; CAS 135402-55-0; Accession Number = P22827; Sequence: EAGEECDCGSP ENPCCDAATCKLRPGAQCADGLCCDQCRFMKKGTVCRVAKGDWN DDTCTGQSADCPRNGLYG) was isolated from the venom of the Southeastern Pigmy Rattlesnake (Sistrurus miliarius barbouri), the only of 52 venoms specific for integrin GPIIb-IIIa versus other integrins. Barbourin is highly homologous to other peptides of the viper venom GPIIb-IIIa antagonist family, but contains a Lys-Gly-Asp (KGD) in place of the canonical Arg-Gly-Asp (RGD) sequence needed to inhibit receptor function. Barbourin represents a new structural model for designing potent and GPIIb IIIa-specific, platelet aggregation inhibitors (See Eptifibatide for details on Mechanism of Action).
barbourin Preparation Products And Raw materials
Tag:barbourin(135402-55-0) Related Product Information
  • HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.