| Company Name: |
GL Biochem (Shanghai) Ltd
|
| Tel: |
21-61263452 13641803416 |
| Email: |
ymbetter@glbiochem.com |
| Products Intro: |
Product Name:Prepro-adrenomedullin (153-185), human;SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
|
| Company Name: |
Nanjing Peptide Biotech Ltd.
|
| Tel: |
025-025-58361106-805-805 13082558573 |
| Email: |
liugang@njpeptide.com |
| Products Intro: |
Product Name:Prepro-adrenomedullin (153 -185)(Human)
Purity:90%HPLC,95%HPLC,98%HPLC Package:5mg,20mg,100mg,250mg,500mg,1g
|
| Company Name: |
Nanjing Meihao Pharmaceutical Technology Co., Ltd.
|
| Tel: |
meitaochem@126.com |
| Email: |
meitaochem@126.com |
| Products Intro: |
Product Name:Prepro-adrenomedullin (153-185), human; SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Purity:99% HPLC Package:500g;1kg;5kg;25kg
|
| Company Name: |
Nanjing Shizhou Biology Technology Co.,Ltd
|
| Tel: |
13675144456 |
| Email: |
alan.chow@synzest.com |
| Products Intro: |
Product Name:Prepro-adrenomedullin(153- 185),human
Purity:95% HPLC Package:100mg;250mg;500mg;1g;5g Remarks:apnoke
|
|
| | Prepro-adrenomedullin (153 - 185), human Basic information |
| Product Name: | Prepro-adrenomedullin (153 - 185), human | | Synonyms: | Prepro-adrenomedullin (153 - 185), human;SER-LEU-PRO-GLU-ALA-GLY-PRO-GLY-ARG-THR-LEU-VAL-SER-SER-LYS-PRO-GLN-ALA-HIS-GLY-ALA-PRO-ALA-PRO-PRO-SER-GLY-SER-ALA-PRO-HIS-PHE-LEU;SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL | | CAS: | | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | peptide | | Mol File: | Mol File | ![Prepro-adrenomedullin (153 - 185), human Structure]() |
| | Prepro-adrenomedullin (153 - 185), human Chemical Properties |
| | Prepro-adrenomedullin (153 - 185), human Usage And Synthesis |
| | Prepro-adrenomedullin (153 - 185), human Preparation Products And Raw materials |
|