Welcome to chemicalbook!
+1 (818) 612-2111
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

RFQ
skype
MY Account
Top
Postion:Product Catalog >Beta-Amyloid 1-40 (scrambled)
Beta-Amyloid 1-40 (scrambled)
  • Beta-Amyloid 1-40 (scrambled)

Beta-Amyloid 1-40 (scrambled)

Price $1
Package 5MG
Min. Order: 5MG
Supply Ability: 5mg,10mg,25mg,100mg,1g,10g
Update Time: 2018-07-30

Product Details

Product Name: Beta-Amyloid 1-40 (scrambled) Min. Order: 5MG
Purity: >95% Supply Ability: 5mg,10mg,25mg,100mg,1g,10g
Release date: 2018/07/30

Seqence: AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA

Company Profile Introduction

We are an internationally renowned company with a wealth of experience offering high quality peptides to life science professionals worldwide. The company is dedicated to provide custom peptide synthesis services and custom antibody service to research institutions throughout the world. We are staffed by a team of experienced experts in the fields of peptide synthesis, antibody and protein production, and equipped with the latest technologies and state-of-the-art instrumentations, which allows us to provide our customers with thoughtful services and premium quality products. With all the manufacturing processes performed under rigorous quality control and management, we have gained a longstanding reputation and trust from our customers by striving toward their needs and satisfaction with quality guaranteed products.

You may like

Recommended supplier

Product name Price   Suppliers Update time
$10.00/1kg
VIP4Y
Hebei Chuanghai Biotechnology Co,.LTD
2024-08-22
$1.00/1KG
Ouhuang Engineering Materials (Hubei) Co., Ltd
2024-04-29
$0.10/1kg
VIP2Y
Zibo Hangyu Biotechnology Development Co., Ltd
2024-01-10
  • Since: 2009-07-17
  • Address: No.33 MONG KOK ROAD, KOWLOON,HK
INQUIRY