Product Details
Product Name:
CECROPIN A |
CAS No.:
80451-04-3 |
Min. Order:
1KG |
Purity:
98% |
Supply Ability:
1ton |
Release date:
2022/10/09 |
1. Product Information
CECROPIN A Basic information
Product Name: | CECROPIN A |
Synonyms: | LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2:
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;CECROPIN A;CECROPIN A, PORCINE;H-LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;Cecropin
A
H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2;Cecropin A?/Cecropin A, porcine |
CAS: | 80451-04-3 |
MF: | C184H313N53O46 |
MW: | 4003.78152 |
EINECS: |
|
Product Categories: | peptide |
Mol File: | 80451-04-3.mol |
![Article illustration](https://www.chemicalbook.com/CAS/20180808/GIF/80451-04-3.gif) |
|
CECROPIN A Chemical Properties |
storage temp. | -20°C |
form | powder |
|
Safety Information |
WGK Germany | 3 |
2. Company information
Founded in 2014, Henan Aochuang Chemical Co., Ltd. is committed to the development of medical science and material chemistry technology. Based on the advanced technology for chemical and medical , it specializes in the research, development, and sales of pharmaceutical intermediates, electronic intermediates ,battery material intermediates, and other fine chemicals. The company has professionals who have been engaged in chemical production and sales for many years. It is a vigorous pharmaceutical chemical technology enterprise with professional background.
3. Contact information
For more information about the product, including package , specification, price ,shipment etc, pls contact us freely .
Email address : sales@aochuangchem.com
Telephone No.: +86-037163689365
Mob No.: +86 18638391208
Company Profile Introduction
Founded in 2014, Henan Aochuang Chemical Co., Ltd. is committed to the development of medical science and material chemistry technology. Based on the advanced technology for chemical and
medical , it specializes in the research, development, and sales of pharmaceutical intermediates, electronic intermediates ,battery material intermediates, and other fine chemicals. The company has professionals who have been engaged in chemical production and sales for many years. It is a vigorous pharmaceutical chemical technology enterprise with professional background.
90% of the company's products are sold to Japan, South Korea, Europe and the United States. We have maintained good cooperative relations with many international well-known enterprises, and have been well received by all parties. ?
Adhering to the principle of "quality first, customer first, integrity-based, mutual benefit", the company provides customers with high-quality products ranging from grams to tons, and comprehensive services from products to technology, and is willing to work together with all walks of life. , and jointly contribute to the development of the material and pharmaceutical industry!
You may like
-
CAS:204656-20-2
$0.00 / 1KG
-
CAS:616204-22-9
$0.00 / 1KG
-
Recommended supplier
Product name |
Price |
|
Suppliers |
Update time |
|
$0.10/1kg |
VIP1Y
|
Zibo Hangyu Biotechnology Development Co., Ltd
|
2024-01-12 |