CJC-1295 with DAC NEW
Price | Get Latest Price |
Package | 10box |
Min. Order: | 10box |
Supply Ability: | 10kg |
Update Time: | 2024-10-13 |
Product Details
Product Name: CJC-1295 with DAC | CAS No.: 863288-34-0 |
Min. Order: 10box | Purity: 99% |
Supply Ability: 10kg | Release date: 2024/10/13 |
Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG) |
CAS: | 863288-34-0 |
MF: | C152H252N44O42 |
MW: | 3367.89688 |
EINECS: | 206-141-6 |
Product Categories: | Peptides;CJC;863288-34-0 |
Mol File: | 863288-34-0.mol |
CJC1295 Chemical Properties |
Melting point | > 177° C (dec.) |
density | 1.45 |
storage temp. | -20°C Freezer, Under inert atmosphere |
solubility | Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly) |
form | Solid |
color | White to Off-White |
InChIKey | XOZMWINMZMMOBR-HRDSVTNWSA-N |
Company Profile Introduction
Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China.
It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids, peptides, raw materials, vitamins, food additives, animal and plant extracts, cosmetics, pharmaceutical raw materials and intermediates. The company has complete experimental facilities. Advanced testing instruments ensure the stability of product quality from all aspects. The company has a complete sales service system, and its products are exported to countries all over the world. It has won a good international reputation for its excellent quality and excellent service. The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers, and constantly strict requirements,
Advantages:
1. Samples are provided for test;
2. Good quality products;
3. 100% secure delivery.
4. secure your money, lower the risk
Payment ways: Western Union, Moneygram, Bitcoin, T/T
Delivery: EMS/ EUB/ USPS/ UPS/ TNT/ FEDEX/ DHL etc
Packaging:safe and discreet packaging
Our company Superiority
1 Best service, high quality and reasonable price
2. It's customers' right to choose the package (EMS, DHL, FedEx, UPS);
3. It's customers' right to choose the packing way for his products from many recent effective packing ways
4. Specials are possible when client's order is big enough, including the discount policy;
5.Our company promise to deliver clients' package to his hands safely, or we'll cover the total loss and reship in time;
Our company supply high quality chemical products with the most competitive prices.
If have any need or question, contact us freely.
Hope we can have chances to build good long-term cooperation.
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$0.00/1Box |
VIP1Y
|
American HealthyMorph LLC
|
2024-12-06 | |
$70.00/1box |
VIP6Y
|
Shanghai Longyu Biotechnology Co., Ltd.
|
2024-11-23 | |
$5.00/1BOX |
VIP1Y
|
Hefei zhanzhanda trading Co., LTD
|
2024-10-29 | |
$20.00/1kg |
VIP1Y
|
Shaanxi Franta Biotechnology Co., Ltd
|
2024-09-23 | |
$45.00/1Box |
VIP1Y
|
Qingdao Xinli Technology Development Co., Ltd.
|
2024-07-25 | |
$5.00/5mg |
VIP1Y
|
Hebei Ganmiao New material Technology Co., LTD
|
2024-06-27 | |
$0.10/20mg |
VIP1Y
|
Shanghai Likang New Materials Co., Limited
|
2024-05-28 | |
$85.00/1box |
VIP1Y
|
Strong peptide cross-border e-commerce Co. LTD
|
2024-05-23 | |
$50.00/1KG |
VIP1Y
|
hebei hongtan Biotechnology Co., Ltd
|
2024-05-13 | |
$50.00/1box |
VIP1Y
|
Hebei Zhuanglai Chemical Trading Co.,Ltd
|
2024-05-11 |
- Since: 2020-06-09
- Address: 95A2 Xingyuan East Road, Zhangdian District, Zibo City, Shandong Province, China
INQUIRY