Dulaglutide NEW

Use of Dulaglutide

Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.

1kg/aluminum foil bag or 25kg/drum

1.1kg-10kg packing: 2 P.E. bag inside + 1 foil bag outside
2. 15kg packing: 2 P.E. bag inside + 1 foil bag outside in carton
3. 25kg-50kg packing: 2 P.E. bag inside + 1 foil bag outside in drum

4. Customized packing

Shipping:

1) By Express: EMS/ DHL/ FedEx/ TNT/ UPS for sample or small order

2) By air or Sea for bulk order

Our Services

1) The professional sales reprensentative answers your inquiy on time;

2) We can provide reasonable price, high quality product and prompt shipmen;

3) We can send the goods to your delivery addreee directly, it is relatively safe and fast;

4) Warm sfter sale service, we will help to solve the problems in your usage.

whatsapp/signal/telegram;+8617621705551 

wickr:luckymeng588