![Dulaglutide](/ProductImageEN/2023-10/Large/a7e533c6-a337-487f-ba0b-ed92d4b9bbb7.png)
Dulaglutide NEW
Price | $50 |
Package | 1g |
Min. Order: | 1g |
Supply Ability: | 500t |
Update Time: | 2023-10-12 |
Product Details
Product Name: Dulaglutide | CAS No.: 923950-08-7 |
Min. Order: 1g | Purity: 99% |
Supply Ability: 500t | Release date: 2023/10/12 |
Common Name | Dulaglutide | ||
---|---|---|---|
CAS Number | 923950-08-7 | Molecular Weight | 3314.62 |
Density | 1.4±0.1 g/cm3 | Boiling Point | N/A |
Molecular Formula | C149H221N37O49 | Melting Point | N/A |
MSDS | N/A | Flash Point | N/A |
Use of Dulaglutide
Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
1kg/aluminum foil bag or 25kg/drum
1.1kg-10kg packing: 2 P.E. bag inside + 1 foil bag outside
2. 15kg packing: 2 P.E. bag inside + 1 foil bag outside in carton
3. 25kg-50kg packing: 2 P.E. bag inside + 1 foil bag outside in drum
4. Customized packing
Shipping:
1) By Express: EMS/ DHL/ FedEx/ TNT/ UPS for sample or small order
2) By air or Sea for bulk order
Our Services
1) The professional sales reprensentative answers your inquiy on time;
2) We can provide reasonable price, high quality product and prompt shipmen;
3) We can send the goods to your delivery addreee directly, it is relatively safe and fast;
4) Warm sfter sale service, we will help to solve the problems in your usage.
whatsapp/signal/telegram;+8617621705551
wickr:luckymeng588
Company Profile Introduction
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$10.00/1kg |
VIP4Y
|
Hebei Guanlang Biotechnology Co,.LTD
|
2024-08-09 | |
$0.00/1box |
VIP1Y
|
Shaanxi TNJONE Pharmaceutical Co., Ltd
|
2024-04-17 | |
$0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-04-03 | |
$75.00/1kg |
VIP2Y
|
Zibo Hangyu Biotechnology Development Co., Ltd
|
2023-11-27 | |
$10.00/1kg |
VIP1Y
|
Nantong Guangyuan Chemicl Co,Ltd
|
2023-11-15 | |
$55.00/1g |
VIP1Y
|
Wuhan Quanjinci New Material Co.,Ltd.
|
2023-11-02 | |
$12.36/1G |
Wuhan Han Sheng New Material Technology Co.,Ltd
|
2023-10-27 | ||
$40.00/1kg |
Shanghai Chinqesen Biotechnology Co., Ltd.
|
2023-10-27 | ||
$1.00/1g |
VIP2Y
|
Wuhan Cell Pharmaceutical Co., Ltd
|
2023-09-07 | |
$0.00/1g |
Wuhan Godbullraw Chemical Co.,ltd
|
2022-05-18 |
- Since: 2020-08-12
- Address: Shanghai city
+86-17621705551
asdf@shanghaihg.cn