![Exendin-4](/ProductImageEN/2024-04/Large/9161eab9-ff9d-4cb6-9e34-0d8788a61526.jpg)
Exendin-4 NEW
Price | Get Latest Price | ||
Package | 1Box | 2Box | 5Box |
Min. Order: | 1Box |
Supply Ability: | 50000KG/month |
Update Time: | 2024-07-08 |
Product Details
Product Name: Exendin-4 | CAS No.: 141758-74-9 |
Min. Order: 1Box | Purity: 99 |
Supply Ability: 50000KG/month | Release date: 2024/07/08 |
Product description
Product Name: | Exendin-4 |
Synonyms: | EXENDIN-4;M.W. 4186.61 C184H282N50O60S;H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide, AC 2993, Exendin A, ExendinA;Exendin-4 Exenatide;Exenatide (Exendin-4) |
CAS: | 141758-74-9 |
MF: | C184H282N50O60S |
MW: | 4186.57188 |
EINECS: | 686-356-3 |
Product Categories: | Peptide;Cytokines Growth Factors and Hormones (Obesity);ExendinPeptides for Cell Biology;GLP-1 Receptor LigandsCell Signaling and Neuroscience;LizardObesity Research;Obesity Peptides;-;Other Obesity Research Products;Hormones;Obesity Research;Toxins and Venoms;Glucagon receptor and related;Peptide Receptors |
Mol File: | 141758-74-9.mol |
![]() |
Exendin-4 Chemical Properties |
RTECS | VT9545000 |
storage temp. | −20°C |
Contact Information
Shanghai Ouda New New Technology Center, located in Fengxian District, Shanghai. The company produces more than 1000 kinds of high-quality products I20 production lines to provide OEM services, as one of the most dynamic industry and trade integrated companies in the Chinese market.our advantage comes from our service, we can provide fast delivery. The average delivery time in peak season is less than 15 working days, and the average delivery time in off-season is less than 1 month. We have successfully transported many chemical raw materials to many countries in the world. Good feedback and repeat orders have supported the growth of our company.independent production lines, we have 20 pharmaceutical raw materials, organic solvents and other raw material production lines. In addition, we also have an API production workshop with independent research and development production lines, as well as an API research and development testing center. We can provide you with sample testing and accept small orders. Supply 99%+ quality chemical products. We believe only good quality can bring good cooperation, quality is our key spirit during our production, we are warmly welcome clients and partner from all over the world contact us for everlasting cooperation, Ouda will be your strong, sincere and reliable partner in China.
Advantages:
1. Samples are provided for test;
2. Good quality products;
3. 100% secure delivery.
4. secure your money, lower the risk
5.Payment ways: Western Union, Moneygram, Bitcoin, T/T,USDT、PAYPAL
6.Delivery: EMS/ EUB/ USPS/ UPS/ TNT/ FEDEX/ DHL /DPDetc
7.Packaging:safe and discreet packaging
Our company Superiority
1 Best service, high quality and reasonable price
2. It's customers' right to choose the package (EMS, DHL, FedEx, UPS);
3. It's customers' right to choose the packing way for his products from many recent effective packing ways
4. Specials are possible when client's order is big enough, including the discount policy;
5.Our company promise to deliver clients' package to his hands safely, or we'll cover the total loss and reship in time;
Our company supply high quality chemical products with the most competitive prices.
If have any need or question, contact us freely.
Hope we can have chances to build good long-term cooperation.
Inquiry guide
1. Please send the quantity(Weight) to us, we will arrange our sales to provide the one-for-one service for you.
2.Then we will provide the professional quotation list for you, it will be including all the factors in whole business process(Quality, shipping, payment, files etc.).
3.If you have many products need inquiry, please send the list for us, the product clear information includes CAS + Name + quantity(Weight), we will provide the complete solution for you. We also provide the customization product.
WhatsApp:+13106542038
Email: jan@oudaxin.com
janYang@proton.me
(If the phone is not answered, you can use the email to contact us, see your message)
-Packaging & Shipping-
Company Profile Introduction
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-05-09 | |
$75.00/1kg |
VIP2Y
|
Zibo Hangyu Biotechnology Development Co., Ltd
|
2023-11-01 | |
$30.00/1kg |
Henan Bao Enluo International TradeCo.,LTD
|
2023-08-01 | ||
$0.00/25KG |
VIP5Y
|
Hebei Mojin Biotechnology Co., Ltd
|
2023-06-01 | |
$15.00/1KG |
Zhuozhou Wenxi import and Export Co., Ltd
|
2021-07-10 | ||
$1.00/1g |
VIP4Y
|
WUHAN FORTUNA CHEMICAL CO., LTD
|
2021-06-16 | |
$90.00/10g |
Hebei shuoxi biotechnology co. LTD
|
2020-05-09 | ||
$7.00/1KG |
VIP7Y
|
Career Henan Chemical Co
|
2019-07-01 | |
$15.00/1KG |
Zhuozhou Wenxi import and Export Co., Ltd
|
2021-07-09 | ||
$15.00/1KG |
Zhuozhou Wenxi import and Export Co., Ltd
|
2021-06-26 |
- Since: 2024-01-10
- Address: 1 / F, 281-289 Lixin Road, Fengxian District, Shanghai
+86-15081010295
jan@oudaxin.com