![Sermorelin](/ProductImageEN/2023-08/Large/cf208899-b590-4fe6-9bcd-f2d92e525152.jpg)
Sermorelin NEW
Price | Get Latest Price | ||
Package | 1KG | 5KG | 25KG |
Min. Order: | 1KG |
Supply Ability: | 20 T each week |
Update Time: | 2023-08-14 |
Product Details
Product Name: Sermorelin | CAS No.: 86168-78-7 |
EC-No.: 1312995-182-4 | Min. Order: 1KG |
Purity: 98%~99% | Supply Ability: 20 T each week |
Release date: 2023/08/14 |
we are a supplier of chemical product raw materila. Pharmaceutical intermediates,Peptides, steroid, Testosterone products, Sarm Product,
Caine products, Steroidhormone product . welcome to your inquiry.
let us give you a quote for your reference. we are confident that we can become your regluar supplier with good service and safe shipping . door to door service.
Contact : we chat/whatsapp ID: +8613176845580 ross@zhongda-biotech.com
Product Name: | Sermorelin |
Synonyms: | SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;growth hormone releasing factor*fragment 1-29 ami;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN |
CAS: | 86168-78-7 |
MF: | C149H246N44O42S |
MW: | 3357.93 |
EINECS: | 1312995-182-4 |
Product Categories: | Peptide;Amino Acid Derivatives;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors;Sermorelin;86168-78-7 |
Mol File: | 86168-78-7.mol |
![]() |
Sermorelin Chemical Properties |
Melting point | >189°C (dec.) |
alpha | D20 -63.1° (c = 1 in 30% acetic acid) |
density | 1.45±0.1 g/cm3(Predicted) |
storage temp. | −20°C |
solubility | Acetic Acid (Slightly), Trifluoroacetic Acid (Slightly), Water (Slightly) |
form | Solid |
color | White to Off-White |
Stability: | Hygroscopic |
InChIKey | BVLCEKWPOSAKSZ-YQMCHIOTSA-N |
CAS DataBase Reference | 86168-78-7(CAS DataBase Reference) |
WGK Germany | 3 |
Sermorelin Usage And Synthesis |
Description | Sermorelin is licensed as a diagnostic test for secretion of growth hormone. It is also used for the treatment of growth hormone deficiency in children. However, products containing sermorelin were withdrawn from the United States market by the manufacturer in November 2002. |
Uses | xanthine oxidase inhibitor |
Uses | A peptide hormone that stimulates release of the growth hormone |
Uses | Sermorelin Acetate, was used for characterization of a growth hormone-releasing factor from a human pancreatic islet tumor. |
Side effects | The most common side effect of sermorelin is caused by its injection under your skin. You may experience any of the following at the site of injection: irritation itching sensitivity swelling pain redness |
![Article illustration](/ProductImageEN/2023-08-03/6382665612409048638200856.jpg)
Company Profile Introduction
Shandong Huisheng Import & Export Co., Ltd. is located in Jinan city, Shandong Province, is a collection of domestic trade, international trade in one of the diversified services company. Our goal is to provide customers with high quality solutions and one-stop purchasing experience. At present, the company business scope involves five areas: Organic chemical raw materials, inorganic chemical raw materials, fine chemical raw materials, dangerous chemicals and green environmental protection chemical technology project promotion, and we has also established good relations of cooperation with several well-known enterprises and won the strong support of extensive trust from the new and old customers.
Products are widely used in automobile, household appliances, office supplies, mobile phone accessories, routers, food, medical and other fields. At present, our business covers 30 countries, and our customers mainly come from Australia, New Zealand, Canada, Germany, France, Poland, South Korea, Russia, Bangladesh, Vietnam, Kazakhstan, India, Ghana, Nigeria, South Africa, Egypt and other more than 30 countries.
The company has a sound quality management system and advanced professional equipment, with a positive attitude to meet the changing needs of customers. We take "quality products, quality service, competitive price, timely delivery" as the purpose, looking forward to greater cooperation with overseas customers on the basis of mutual benefit.
Our company provides a wide range of products to meet your various needs. Since its inception, the company has always adhered to the "quality first, customer first, reputation first" business policy, wholeheartedly meet the potential needs of our customers. Under the irresistible situation of economic globalization, our company is willing to cooperate sincerely with enterprises around the world to achieve a win-win situation.
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$10.00/1kg |
VIP1Y
|
Hebei Ganmiao New material Technology Co., LTD
|
2024-06-05 | |
$0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-04-29 | |
$20.00/1box |
VIP1Y
|
Shanghai Getian Industrial Co., LTD
|
2024-04-26 | |
$10.00/1mg |
VIP1Y
|
Hebei Kangcang new material Technology Co., LTD
|
2024-03-29 | |
$10.00/1mg |
VIP1Y
|
Nantong Guangyuan Chemicl Co,Ltd
|
2024-01-17 | |
$0.00/1kg |
VIP1Y
|
Shandong Hanjiang Chemical Co., Ltd
|
2024-01-10 | |
$36.00/1box |
VIP1Y
|
Hebei Xunou new energy Technology Co., LTD
|
2024-01-09 | |
$100.00/10g |
Zhejiang Hangyu API Co., Ltd
|
2023-12-14 | ||
$35.00/1Box |
VIP1Y
|
zhuzhou dingcheng meihei comestic co.,ltd
|
2023-12-06 | |
$0.00/1kg |
VIP1Y
|
Hebei Xinsheng New Material Technology Co., LTD.
|
2023-10-18 |
- Since: 2020-11-16
- Address: Room 202-9, Building 1, Evergrande Huafu, Dongying Road, Huaiyin District, Jinan City, Shandong Prov
INQUIRY
18963783019
da@zhongda-biotech.com