ChemicalBook Chinese Germany Japanese Korean

BOC Sciences Company Information

Company Name:    BOC Sciences
Tel:    -16314854226;
Email:    inquiry@bocsci.com
Nationality:    United States
WebSite:    https://www.bocsci.com/
Product List:    19743
170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198

Product List
Receptor-type tyrosine-protein phosphatase kappa (667-682)
Protein SSX2 (101-111)
Protein SSX2 (41-49)
Sarcoma antigen 1 (715-723)
Talin (777-785)
Receptor tyrosine-protein kinase erbB-2 (63-71)
Receptor tyrosine-protein kinase erbB-2 (391-399)
(S)-2-hydroxy-3-(2-methylphenyl)-propionic acid 458528-68-2
Receptor-type tyrosine-protein kinase FLT3 (591-600)
Putative protein product of HMFN1045 (253-264)
Protein SSX4 (61-80)
PSMA/PSM-P1 (4-12)
Telomerase reverse transcriptase (672-686)
Serine protease hepsin (229-237)
Receptor tyrosine-protein kinase erbB-2 (650-658)
TAG-2 (42-50)
Rho guanine nucleotide exchange factor 17 (425-438)
RER1 protein (80-91)
Small subunit processome component 20 homolog (626-634)
Protein SSX4 (31-50)
PSCA (14-22)
Survivin (18-27)
Telomerase reverse transcriptase (865-873)
Receptor tyrosine-protein kinase erbB-2 (665-673)
Receptor tyrosine-protein kinase erbB-2 (369-377)
SYSMEHFRWGKPS
Telomerase reverse transcriptase (461-469)
Sodium-coupled monocarboxylate transporter 2 (343-356)
Serine/threonine-protein kinase B-raf (586-614)
Protein SSX2 (45-58)
Regulator of G-protein signaling 5 (5-13)
Secernin-1 (196-204)
Receptor tyrosine-protein kinase erbB-2 (754-762)
Receptor tyrosine-protein kinase erbB-2 (1023-1032)
Rhodopsin Epitope Tag
Telomerase reverse transcriptase (540-548)
SSA protein SS-56 (55-64)
Ras-related protein Rab-27A (178-186)
Protein phosphatase 1 regulatory subunit 3B (172-180)
Prostatic acid phosphatase (112-120)
Protein SSX2 (19-34)
Rho-related GTP-binding protein RhoC (176-185)
Serine protease hepsin (191-199)
Receptor tyrosine-protein kinase erbB-2 (466-474)
[pThr3]-CDK5 Substrate 1670273-47-8
TDSP5
Serine/threonine-protein kinase mTOR (89-98)
Protein OS-9 (438-446)
Protein enabled homolog (502-510)
Protein SSX4 (41-60)
PSM P2 (711-719)
Survivin (80-88)
Receptor tyrosine-protein kinase erbB-2 (689-697)
PSMA-PEG4 2256069-92-6
(R)-2-hydroxy-3-(2-methylphenyl)-propionic acid 1932808-80-4
Telomerase Reverse Transcriptase (674-683)
Ribosomal protein S26 (47-61)
Receptor tyrosine-protein kinase erbB-2 precursor (369-386)
Protein timeless homolog (848-856)
Small nuclear ribonucleoprotein Sm D1 (11-19)
Prostatic acid phosphatase (18-26)
Ras-related protein Rab-38 (50-58)
Protein SSX4 (151-170)
Regulator of G-protein signaling 5 (74-83)
Sperm surface protein Sp17 (103-111)
Receptor tyrosine-protein kinase erbB-2 (48-56)
Receptor tyrosine-protein kinase erbB-2 (5-13)
STh 118447-40-8
(S)-2-hydroxy-3-(3-methylphenyl)-propionic acid 458528-71-7
St-Ht31 P 252869-81-1
Proto-oncogene PIM1 (191-199)
Structure-specific endonuclease subunit SLX4 (603-615)
Rabenosyn-5 (541-552)
Prostatic acid phosphatase (299-307)
Retinal dehydrogenase 1 (88-96)
Protein enabled homolog (443-451)
Protein SSX2 (37-54)
Ribosome-binding protein 1 (879-887)
Receptor tyrosine-protein kinase erbB-2 (402-410)
Protein SSX4 (51-70)
PSMA (27-38)
Survivin-3A (96-104)
Telomerare Reverse Transcriptase (hTRT) (653-661)
Serine protease hepsin (268-276)
Receptor tyrosine-protein kinase erbB-2 (435-443)
TAMRA-β-Amyloid (1-42), human 1802087-80-4
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Siyry 178561-37-0
TAG-1 A2 (78-86)
Secretin (5-27) (Porcine) 19665-15-7
RPL8 protein (31-41)
Protein SSX2 (45-59)
SYT-SSX1 or -SSX2 fusion protein (402-410 (SYT))
Protein SSX4 (161-180)
Surface IgG (sA20-Ig) of A20 (106-114)
Telomerase reverse transcriptase (766-780)
Receptor tyrosine-protein kinase erbB-2 (952-961)
Receptor tyrosine-protein kinase erbB-2 (654-662)
[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor 1142-1153 141171-54-2
(R)-2-hydroxy-3-(3-methylphenyl)-propionic acid 374119-33-2
170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198

Copyright 2007©  ChemicalBook. All rights reserved.