GLP-2 (HUMAN)
![]() |
- $180 - $1140
- Product name: GLP-2 (HUMAN)
- CAS: 223460-79-5
- MF: C165H254N44O55S
- MW: 3766.10906
- EINECS:
- MDL Number:MFCD00081649
- Synonyms:PREPROGLUCAGON (146-179) (HUMAN) TRIFLUOROACETATE SALT;PREPROGLUCAGON (126-159) (HUMAN);PREPROGLUCAGON (146-178) (HUMAN);HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP;H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-ARG-OH;H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLAARDFINWLIQTKITDR;GLP-2
9 prices
Selected condition:
Brand
- ApexBio Technology
- ChemScene
- Tocris
- Usbiological
Package
- 1
- 500ug
- 1mg
- 5mg
- 48Tests
- 96Tests
- ManufacturerApexBio Technology
- Product numberB5281
- Product descriptionGLP-2(human)
- Packaging1mg
- Price$394
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-7691
- Product descriptionGLP-2(1-33)(human) 99.28%
- Packaging500ug
- Price$180
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-7691
- Product descriptionGLP-2(1-33)(human) 99.28%
- Packaging1mg
- Price$300
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-7691
- Product descriptionGLP-2(1-33)(human) 99.28%
- Packaging5mg
- Price$1140
- Updated2021-12-16
- Buy
- ManufacturerTocris
- Product number2258
- Product descriptionGLP-2(human)
- Packaging1
- Price$314
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberG2040-37B
- Product descriptionGlucagon-like Peptide 2
- Packaging1mg
- Price$368
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number355984
- Product descriptionGLP2
- Packaging48Tests
- Price$588
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberG2040-37C
- Product descriptionGlucagon-like Peptide 2
- Packaging1mg
- Price$701
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number152607
- Product descriptionGlucagon Like Peptide 2
- Packaging96Tests
- Price$972
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
ApexBio Technology | B5281 | GLP-2(human) | 1mg | $394 | 2021-12-16 | Buy |
ChemScene | CS-7691 | GLP-2(1-33)(human) 99.28% | 500ug | $180 | 2021-12-16 | Buy |
ChemScene | CS-7691 | GLP-2(1-33)(human) 99.28% | 1mg | $300 | 2021-12-16 | Buy |
ChemScene | CS-7691 | GLP-2(1-33)(human) 99.28% | 5mg | $1140 | 2021-12-16 | Buy |
Tocris | 2258 | GLP-2(human) | 1 | $314 | 2021-12-16 | Buy |
Usbiological | G2040-37B | Glucagon-like Peptide 2 | 1mg | $368 | 2021-12-16 | Buy |
Usbiological | 355984 | GLP2 | 48Tests | $588 | 2021-12-16 | Buy |
Usbiological | G2040-37C | Glucagon-like Peptide 2 | 1mg | $701 | 2021-12-16 | Buy |
Usbiological | 152607 | Glucagon Like Peptide 2 | 96Tests | $972 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
solubility :Soluble to 1 mg/ml in 5% NH4OH / water
form :solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in 5% NH4OH / water
Sequence :H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
solubility :Soluble to 1 mg/ml in 5% NH4OH / water
form :solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in 5% NH4OH / water
Sequence :H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
GLP-2 is cosecreted with GLP-1 in response to nutrient ingestion. The principal role of GLP-2 appears to be the maintenance of the growth and absorptive function of the intestinal mucosal villus epithelium. GLP-2 was first identified as a novel peptide following the cloning of the proglucagon gene in the early 1980s, and subsequently the biosynthesis and release of GLP-2 were confirmed by isolation and characterization from the porcine and human small intestine. The biological role of GLP-2 as a stimulator of intestinal epithelial proliferation was first demonstrated in 1996.Related product price
- Ethyl isocyanoacetate
$13.43-860 - COBALT(II) ACETYLACETONATE
$43-524 - METHYL ISOCYANOACETATE
$35-1275