ChemicalBook >> CAS DataBase List >>BNP-32 (HUMAN)

BNP-32 (HUMAN)

CAS No.
124584-08-3
Chemical Name:
BNP-32 (HUMAN)
Synonyms
BNP HUMAN;Nesiritide;BNP-32 (HUMAN);Nesiritide TFA;BNP (1-32), HUMAN;Nesiritide (BNP-32);Brain natriuretic pe;Nesiritide [USAN:INN];BNP-32 (HUMAN) USP/EP/BP;BNP-32 (human) hydrochloride
CBNumber:
CB1676347
Molecular Formula:
C143H244N50O42S4
Molecular Weight:
3464.04
MDL Number:
MFCD00133149
MOL File:
124584-08-3.mol
Last updated:2024-03-27 11:49:37

BNP-32 (HUMAN) Properties

Density 1.52±0.1 g/cm3(Predicted)
RTECS EE1534000
storage temp. −20°C
form powder
Water Solubility Soluble in water at 1mg/ml
Sequence H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Disulfide bridge: Cys10-Cys26)
CAS DataBase Reference 124584-08-3
EWG's Food Scores 1
FDA UNII P7WI8UL647
ATC code C01DX19
NCI Drug Dictionary nesiritide

SAFETY

Risk and Safety Statements

WGK Germany  3

BNP-32 (HUMAN) price More Price(18)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich B5900 Brain Natriuretic Peptide-32 human ≥97% (HPLC), powder 124584-08-3 0.5mg $596 2024-03-01 Buy
Sigma-Aldrich B5900 Brain Natriuretic Peptide-32 human ≥97% (HPLC), powder 124584-08-3 1mg $1100 2024-03-01 Buy
Alfa Aesar J66167 Brain Natriuretic Peptide (1-32), human 124584-08-3 1mg $381 2023-06-20 Buy
Alfa Aesar J66167 Brain Natriuretic Peptide (1-32), human 124584-08-3 0.5mg $200 2021-12-16 Buy
Tocris 3522 Brain Natriuretic Peptide (1-32), human 124584-08-3 1 $432 2021-12-16 Buy
Product number Packaging Price Buy
B5900 0.5mg $596 Buy
B5900 1mg $1100 Buy
J66167 1mg $381 Buy
J66167 0.5mg $200 Buy
3522 1 $432 Buy

BNP-32 (HUMAN) Chemical Properties,Uses,Production

Description

Nesiritide was introduced in the US as a new intravenous treatment for patients with acutely decompensated congestive heart failure who have dyspnea at rest or with minimal activity. Nesiritide is the first human recombinant form of the potent vasodilatory B-type natriuretic peptide (also known as brain natriuretic peptide), a naturally occurring 32 amino acid peptide with a disulfide-bonded 17 amino acid ring structure. Nesiritide binds to the Atype natriuretic peptide receptor on the surface of endothelial and smooth muscle cells stimulating production of the second messenger cGMP which mediates predominantly vascular smooth muscle cell relaxation. It also facilitates the elimination of sodium and water by the kidney and decreases the secretion of certain hormones, such as adrenalin, angiotensin II, aldosterone and endothelin, which provoke long-term detrimental effects including blood vessel constriction and blood pressure elevation. In clinical trials with heart failure patients, nesidtide dose-dependently reduced pulmonary capillary wedge pressure, right atrial pressure and systemic vascular resistance and increased cardiac index without affecting heart rate. The major adverse effect observed was dose-dependent hypotension. In a phase III comparative trial, nesiritide was found to be superior to iv. nitroglycerine in its haemodynamic effects as well as easier to administer and better tolerated. Nesiritide is cleared by proteolytic cleavage by the enzyme neutral endopeptidase NEP24.11 and by binding to the C-type natriuretic peptide receptor followed by endocytosis and intracellular lysosomal hydrolysis. Since it has a short half-life (18 min), nesiritide is administered as a 21μg/kg bolus infusion followed by a continuous maintenance infusion at 0.011μg/kg/min usually over 24-48 hours.

Originator

Scios (US)

Uses

Brain natriuretic peptide is originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis.

Uses

Treatment of congestive heart failure (renin-angiotensin system antagonist).

brand name

Natrecor (Biochemie, Austria).

General Description

The gene encoding brain natriuretic peptide-32 (BNP-32) is localized on human chromosome 1p36.22. It is implicated in several biological functions such as diuresis, natriuresis, hypotensive action and inhibition of aldosterone secretion. BNP-32 acts as a potential biomarker of high left ventricular-diastolic pressure in patients with symptomatic left ventricular (LV) dysfunction. Elevated expression of this protein is observed in acute myocardial infarction (AMI) patients.

Biochem/physiol Actions

Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis.

storage

Store at -20°C

BNP-32 (HUMAN) Preparation Products And Raw materials

Raw materials

Preparation Products

BNP-32 (HUMAN) Suppliers

Global( 103)Suppliers
Supplier Tel Email Country ProdList Advantage
Henan Tengmao Chemical Technology Co. LTD
+8615238638457 salesvip2@hntmhg.com China 415 58
Alpha Biopharmaceuticals Co., Ltd
+86-411-39042497 +8613921981412 sales@alphabiopharm.com China 886 58
Henan Tianfu Chemical Co.,Ltd.
+86-0371-55170693 +86-19937530512 info@tianfuchem.com China 21689 55
Shenzhen Nexconn Pharmatechs Ltd
+86-755-89396905 +86-15013857715 admin@nexconn.com China 10248 58
Hubei Jusheng Technology Co.,Ltd.
18871490254 linda@hubeijusheng.com CHINA 28180 58
Alchem Pharmtech,Inc.
8485655694 sales@alchempharmtech.com United States 63711 58
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
Fuxin Pharmaceutical
+86-021-021-50872116 +8613122107989 contact@fuxinpharm.com China 10297 58
Hebei Yanxi Chemical Co., Ltd.
+8617531190177 peter@yan-xi.com China 6000 58
Hubei Ipure Biology Co., Ltd
+8613367258412 ada@ipurechemical.com China 10326 58

View Lastest Price from BNP-32 (HUMAN) manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
BNP-32 (HUMAN) pictures 2023-11-30 BNP-32 (HUMAN)
124584-08-3
US $220.00-210.00 / kilograms 1kilograms 99% 500tons Henan Tengmao Chemical Technology Co. LTD
 BNP-32 (HUMAN) pictures 2023-05-27 BNP-32 (HUMAN)
124584-08-3
US $45.00 / kg 1kg 99% 20tons Henan Bao Enluo International TradeCo.,LTD
Nesiritide pictures 2023-01-12 Nesiritide
124584-08-3
US $0.00 / g 1g 98%min 1000g WUHAN FORTUNA CHEMICAL CO., LTD
  • BNP-32 (HUMAN) pictures
  • BNP-32 (HUMAN)
    124584-08-3
  • US $220.00-210.00 / kilograms
  • 99%
  • Henan Tengmao Chemical Technology Co. LTD
  •  BNP-32 (HUMAN) pictures
  • BNP-32 (HUMAN)
    124584-08-3
  • US $45.00 / kg
  • 99%
  • Henan Bao Enluo International TradeCo.,LTD
  • Nesiritide pictures
  • Nesiritide
    124584-08-3
  • US $0.00 / g
  • 98%min
  • WUHAN FORTUNA CHEMICAL CO., LTD
Nesiritide [USAN:INN] SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26) SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26) BRAIN NATRIURETIC PEPTIDE (1-32), HUMAN BRAIN(B-TYPE) NATRIURETIC PEPTIDE-32 (HUMAN) BRAIN NATRIURETIC PEPTIDE, HUMAN BRAIN NATRIURETIC PEPTIDE-32 (HUMAN) B-TYPE (BRAIN) NATRIURETIC PEPTIDE-32 (HUMAN) BNP HUMAN BNP-32 (HUMAN) BNP (1-32), HUMAN BNP-32 (huMan) Brain Natriuretic Peptide-32 (huMan), Nesiritide Brain Natriuretic Peptide-32 (huMan), Nesiritide H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH Acetate salt (Disulfide bond) Nesiritide Nesiritide,Brain Natriuretic Peptide-32 human,BNP-32, >98% BNP-32 (human) hydrochloride Nesiritide (BNP-32) Brain Natriuretic Peptide (BNP) (1-32), human L-Histidine, L-seryl-L-prolyl-L-lysyl-L-methionyl-L-valyl-L-glutaminylglycyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-lysyl-L-methionyl-L-α-aspartyl-L-arginyl-L-isoleucyl-L-seryl-L-seryl-L-seryl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-lysyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-,... BNP-32 (HUMAN) USP/EP/BP Brain natriuretic pe 124584-08-3 Nesiritide [USAN:INN] Nesiritide,Brain Natriuretic Peptide-32 human,BNP-32 Nesiritide TFA 124584-08-3 C143H224N50O42S4 Peptides Natriuretic Peptides Amino Acids and Peptides BioChemical Biochemicals and Reagents Elisa Kit-Mouse Elisa Kit