BNP-32 (HUMAN)
- $130 - $1342.6
- Product name: BNP-32 (HUMAN)
- CAS: 124584-08-3
- MF: C143H244N50O42S4
- MW: 3464.04
- EINECS:1312995-182-4
- MDL Number:MFCD00133149
- Synonyms:Nesiritide [USAN:INN];SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26);SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS;H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH;H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26);BRAIN NATRIURETIC PEPTIDE (1-32), HUMAN;BRAIN(B-TYPE) NATRIURETIC PEPTIDE-32 (HUMAN);BRAIN NATRIURETIC PEPTIDE, HUMAN
17 prices
Selected condition:
Brand
- AK Scientific
- Alfa Aesar
- ApexBio Technology
- Biosynth Carbosynth
- Sigma-Aldrich
- Tocris
Package
- 250ug
- 1
- 100ug
- 0.5mg
- 500ug
- 1mg
- 2mg
- 5mg
- 10mg
- ManufacturerAK Scientific
- Product number9798AJ
- Product descriptionNesiritide
- Packaging1mg
- Price$455
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66167
- Product descriptionBrain Natriuretic Peptide (1-32), human
- Packaging0.5mg
- Price$200
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66167
- Product descriptionBrain Natriuretic Peptide (1-32), human
- Packaging1mg
- Price$381
- Updated2023-06-20
- Buy
- ManufacturerApexBio Technology
- Product numberB5442
- Product descriptionBrain Natriuretic Peptide (1-32), human
- Packaging1mg
- Price$441
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110257
- Product descriptionBNP-32 (human) hydrochloride
- Packaging500ug
- Price$130
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110377
- Product descriptionBNP-32 (human)
- Packaging100ug
- Price$150
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110377
- Product descriptionBNP-32 (human)
- Packaging250ug
- Price$200
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110257
- Product descriptionBNP-32 (human) hydrochloride
- Packaging1mg
- Price$227
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110377
- Product descriptionBNP-32 (human)
- Packaging500ug
- Price$250
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110377
- Product descriptionBNP-32 (human)
- Packaging1mg
- Price$300
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110257
- Product descriptionBNP-32 (human) hydrochloride
- Packaging2mg
- Price$386
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110377
- Product descriptionBNP-32 (human)
- Packaging2mg
- Price$450
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110257
- Product descriptionBNP-32 (human) hydrochloride
- Packaging5mg
- Price$772
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFB110257
- Product descriptionBNP-32 (human) hydrochloride
- Packaging10mg
- Price$1342.6
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberB5900
- Product descriptionBrain Natriuretic Peptide-32 human ≥97% (HPLC), powder
- Packaging0.5mg
- Price$596
- Updated2024-03-01
- Buy
- ManufacturerSigma-Aldrich
- Product numberB5900
- Product descriptionBrain Natriuretic Peptide-32 human ≥97% (HPLC), powder
- Packaging1mg
- Price$1100
- Updated2024-03-01
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
AK Scientific | 9798AJ | Nesiritide | 1mg | $455 | 2021-12-16 | Buy |
Alfa Aesar | J66167 | Brain Natriuretic Peptide (1-32), human | 0.5mg | $200 | 2021-12-16 | Buy |
Alfa Aesar | J66167 | Brain Natriuretic Peptide (1-32), human | 1mg | $381 | 2023-06-20 | Buy |
ApexBio Technology | B5442 | Brain Natriuretic Peptide (1-32), human | 1mg | $441 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110257 | BNP-32 (human) hydrochloride | 500ug | $130 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110377 | BNP-32 (human) | 100ug | $150 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110377 | BNP-32 (human) | 250ug | $200 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110257 | BNP-32 (human) hydrochloride | 1mg | $227 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110377 | BNP-32 (human) | 500ug | $250 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110377 | BNP-32 (human) | 1mg | $300 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110257 | BNP-32 (human) hydrochloride | 2mg | $386 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110377 | BNP-32 (human) | 2mg | $450 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110257 | BNP-32 (human) hydrochloride | 5mg | $772 | 2021-12-16 | Buy |
Biosynth Carbosynth | FB110257 | BNP-32 (human) hydrochloride | 10mg | $1342.6 | 2021-12-16 | Buy |
Sigma-Aldrich | B5900 | Brain Natriuretic Peptide-32 human ≥97% (HPLC), powder | 0.5mg | $596 | 2024-03-01 | Buy |
Sigma-Aldrich | B5900 | Brain Natriuretic Peptide-32 human ≥97% (HPLC), powder | 1mg | $1100 | 2024-03-01 | Buy |
Properties
Density :1.52±0.1 g/cm3(Predicted)
RTECS :EE1534000
storage temp. :−20°C
form :powder
Water Solubility :Soluble in water at 1mg/ml
Sequence :H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Disulfide bridge: Cys10-Cys26)
CAS DataBase Reference :124584-08-3
RTECS :EE1534000
storage temp. :−20°C
form :powder
Water Solubility :Soluble in water at 1mg/ml
Sequence :H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Disulfide bridge: Cys10-Cys26)
CAS DataBase Reference :124584-08-3
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
Brain natriuretic peptide is originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis.Related product price
- Nesiritide acetate
$110-2563.6 - Octreotide
$59-1871.1 - Liraglutide
$70-1991.25