ChemicalBook >> CAS DataBase List >>NEUROMEDIN B

NEUROMEDIN B

CAS No.
87096-84-2
Chemical Name:
NEUROMEDIN B
Synonyms
NMB;NEUROMEDIN B;GNLWATGHFM-NH2;Pig neuromedin B;NEUROMEDIN B ≥90%;NEUROMEDIN BNEUROMED;Porcine neuromedin B;Neuromedin B (porcin;NEUROMEDIN B, PORCINE;Neuromedin B, ≥90% (HPLC)
CBNumber:
CB1328763
Molecular Formula:
C52H73N15O12S
Molecular Weight:
1132.29
MDL Number:
MFCD00167607
MOL File:
87096-84-2.mol
MSDS File:
SDS
Last updated:2024-07-02 08:55:00

NEUROMEDIN B Properties

Boiling point 1697.4±65.0 °C(Predicted)
Density 1.337±0.06 g/cm3(Predicted)
storage temp. −20°C
solubility H2O : 12.5 mg/mL (11.04 mM; Need ultrasonic)
form Solid
pka 13.16±0.46(Predicted)
color White to off-white
Water Solubility Soluble to 1 mg/ml in water
Sequence H-Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2

SAFETY

Risk and Safety Statements

WGK Germany  3

NEUROMEDIN B price More Price(17)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich N3762 Neuromedin B ≥90% (HPLC) 87096-84-2 1mg $309 2024-03-01 Buy
Alfa Aesar J66286 Neuromedin B 87096-84-2 1mg $105 2023-06-20 Buy
Tocris 1908 NeuromedinB(porcine) 87096-84-2 1 $149 2021-12-16 Buy
TRC N391003 NeuromedinB,Porcine 87096-84-2 1mg $145 2021-12-16 Buy
Usbiological N2171-76 Neuromedin B 87096-84-2 1mg $531 2021-12-16 Buy
Product number Packaging Price Buy
N3762 1mg $309 Buy
J66286 1mg $105 Buy
1908 1 $149 Buy
N391003 1mg $145 Buy
N2171-76 1mg $531 Buy

NEUROMEDIN B Chemical Properties,Uses,Production

Discovery

NMB was purified from the porcine spinal cord in 1983 as one of the peptides with a stimulant effect on rat uterus contraction. NMB is structurally related to ranatensin, an amphibian peptide belonging to the bombesin-like peptide family, which was purified in 1970 by Nakajima. NMB cDNA was first isolated in the human and then in the rat.

Structure

NMB was first identified as a decapeptide, but subsequently 30 (NMB-30) or 32 (NMB-32) forms were also identified. The decapeptide (NMB) is also noted as NMB23–32. The C-terminal residue of the peptide is amidated. The amino acid sequences for the pig, human, and rat NMB-32 are highly conserved, and only differ in 4 aa. Their sequences of 11 aa from the C-terminus are completely identical.

Gene, mRNA, and precursor

Human NMB is located on chromosome 15 (15q25.2) and consists of three exons. Human NMB is encoded in a 76-aa precursor protein (preproNMB), which consists of a 24-aa signal peptide, a 32-aa mature peptide (NMB-32), and a 17-aa C-terminal extended peptide. The C-terminus of NMB-32 is flanked by a Gly-Lys-Lys sequence, which is a target for proteolytic processing. Nmb in rats consists of three exons, and the intron-exon border is well conserved in humans and rats. Rat preproNMB is 117 aa long, and its structure is similar to that of human preproNMB. The difference exists in the length of the extended peptide, which is 52 aa long instead of 17 aa, and the existence of a cleavage recognition site at the C-terminus of the extended peptide.

Receptors

NMB binds the NMB-preferring receptor (NMBR, also called BB1) with high affinity (Ki = 4 nM for rat NMBR-transfected BALB3T3 cells), and also binds the gastrin-releasing peptide-preferring receptor with much lower affinity (Ki = 174 nM for mouse GRPRtransfected BALB3T3 cells). NMBR is a GPCR with seven-transmembrane domains. The TM5 segment is shown to be critical for high affinity and selectivity for agonist binding. NMBR has been cloned in humans, rats,mice, chicks, and frogs. Both human and rat NMBR cDNAs encode a 390-aa residue protein, and the calculated Mr is 43 kDa in rats. The sequence similarity of the NMBR genes in mice, rats, and humans is 90%–97%. In rats, Nmbr mRNA is detected notably in the olfactory regions, hippocampal formations, amygdala, thalamus, and central core, and moderate expression is found in many other brain regions. In the peripheral organs, strong expression is found in the rat and mouse esophagus, and significant levels of expression have been found by RT-PCR in the intestines, testis, and uterus in mice.

Agonists and Antagonists

NMB is a naturally occurring agonist for NMBR. GRP and NMC are naturally occurring agonists with lower affinity for NMBR than GRPR. Labeled bombesin (BN) analogs are useful for tumor imaging and BN receptor mediated cytotoxicity.  PD168368 and PD176252 are antagonists with high selectivity for the human NMBR.

Biological functions

NMB regulates smooth muscle contraction, exocrine and endocrine secretions, body temperature, food intake, energy homeostasis, grooming and scratching (itch perception), nociception, anxiety, sighing, locomotion, and cell growth. The contractile effect of NMB is found to be more potent than that of GRP in the rat urinary bladder and esophagus.

Clinical implications

NMBR is expressed in various human cancers, including small cell lung carcinoma, nonsmall cell lung carcinoma, colon cancer, and various carcinoid tumors, and NMB may have a growth effect. Because NMB has a regulatory function for TSH release, NMB could be implicated in human thyroid disorders.

Description

NMB is distributed in the central nervous system as well as the gastrointestinal tract, and has many regulatory functions in physiology such as exocrine and endocrine secretions, smooth muscle contraction, feeding, energy homeostasis, body temperature, nociception, itch perception, anxiety, sighing, and cell growth.

Uses

Neuromedin B, porcine is an endogenous activator for the NMBR (neuromedin B receptor).

General Description

Neuromedin B (NMB) belongs to the bombesin (BN)-like peptide family in mammals. It is located in the gastrointestinal tract and central nervous system.

Biochem/physiol Actions

Neuromedin B (NMB) exhibits its effects by binding to the cell surface receptors. It facilitates its action on several contractile organs including, the stomach, intestine, esophagus, gall bladder, urinary bladder, and uterus. It also plays a role in food intake, hypothermia, and thermoregulation. NMB is involved in exocrine and endocrine secretion of gastrin, insulin, cholecystokinin, enteroglucagon, and gastric inhibitory peptide. It also acts as an autocrine growth factor in non-small cell lung cancer.

storage

Store at -20°C

NEUROMEDIN B Preparation Products And Raw materials

Raw materials

Preparation Products

NEUROMEDIN B Suppliers

Global( 103)Suppliers
Supplier Tel Email Country ProdList Advantage
Shenzhen Nexconn Pharmatechs Ltd
+86-755-89396905 +86-15013857715 admin@nexconn.com China 10318 58
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
career henan chemical co
+86-0371-86658258 +8613203830695 factory@coreychem.com China 29826 58
BOC Sciences
16314854226; +16314854226 inquiry@bocsci.com United States 19743 58
Zhejiang J&C Biological Technology Co.,Limited
+1-2135480471 +1-2135480471 sales@sarms4muscle.com China 10522 58
Hangzhou Go Top Peptide Biotech
0571-88211921 sales1@gotopbio.com CHINA 2609 58
Chengdu Youngshe Chemical Co., Ltd.
+8618108235634 Cecilia@youngshechem.com China 2345 58
Hu Bei Jiutian Bio-medical Technology CO.,Ltd
027-88013699 17354350817 Ryan@jiutian-bio.com China 7432 58
Nanjing TGpeptide
+86-13347807150 +86-13347807150 support@tgpeptide.com China 3279 58
Zhejiang Hangyu API Co., Ltd
+8617531972939 anna@api-made.com China 2944 58

View Lastest Price from NEUROMEDIN B manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
NEUROMEDIN B pictures 2020-02-19 NEUROMEDIN B
87096-84-2
US $7.00 / KG 1KG 99% 100kg Career Henan Chemical Co
  • NEUROMEDIN B pictures
  • NEUROMEDIN B
    87096-84-2
  • US $7.00 / KG
  • 99%
  • Career Henan Chemical Co

NEUROMEDIN B Spectrum

Porcine neuromedin B Neuromedin B (swinespinal cord) (9CI) NEUROMEDIN BNEUROMED ANTI-NMB (CENTER) antibody produced in rabbit NMB NEUROMEDIN B (HUMAN, PORCINE, RAT) NEUROMEDIN B (HUMAN, PORCINE, RAT) ACOH 5H2O NEUROMEDIN B, PORCINE NEUROMEDIN B H-GLY-ASN-LEU-TRP-ALA-THR-GLY-HIS-PHE-MET-NH2 GNLWATGHFM-NH2 GLY-ASN-LEU-TRP-ALA-THR-GLY-HIS-PHE-MET-NH2 GLY-ASN-LEU-TRP-ALA-THR-GLY-HIS-PHE-MET-NH2 ACOH 5H2O NEUROMEDIN B, PORCINE MAMMALIAN BOMBESIN -LI Gly-L-Asn-L-Leu-L-Trp-L-Ala-L-Thr-Gly-L-His-L-Phe-L-Met-NH2 LEU-SER-TRP-ASP-LEU-PRO-GLU-PRO-ARG-SER-ARG-ALA-GLY-LYS-ILE-ARG-VAL-HIS-PRO-ARG-GLY-ASN-LEU-TRP-ALA-THR-GLY-HIS-PHE-MET-NH2: LSWDLPEPRSRAGKIRVHPRGNLWATGHFM-NH2 NEUROMEDIN B ≥90% Neuromedin B (pig spinal cord) Pig neuromedin B Neuromedin B, ≥90% (HPLC) Neuromedin B (swine spinal cord) Neuromedin B (porcin Inhibitor,inhibit,Neuromedin B,Endogenous Metabolite L-Methioninamide, glycyl-L-asparaginyl-L-leucyl-L-tryptophyl-L-alanyl-L-threonylglycyl-L-histidyl-L-phenylalanyl- 87096-84-2 C52H73N15O12S C52H73N15O12S1 Cancer Research BioChemical Tumor Promotors Tumor Growth Regulation Peptide BombesinsCancer Research Neuropeptides Peptides for Cell Biology Tumor Growth Regulation Tumor Promotors Neuromedins and related