ChemicalBook >> CAS DataBase List >>BNP-32 (HUMAN)

BNP-32 (HUMAN)

BNP-32 (HUMAN) structure

CAS No.: 124584-08-3

Chemical Name:: BNP-32 (HUMAN)

Synonyms: BNP HUMAN;Nesiritide;BNP-32 (HUMAN);Nesiritide TFA;BNP (1-32), HUMAN;Nesiritide (BNP-32);Brain natriuretic pe;Nesiritide [USAN:INN];BNP-32 (HUMAN) USP/EP/BP;BNP-32 (human) hydrochloride

CBNumber:: CB1676347

Molecular Formula:: C143H244N50O42S4

Molecular Weight:: 3464.05

MDL Number:: MFCD00133149

MOL File:: 124584-08-3.mol

Last updated:2024-10-31 13:32:20

Request For Quotation

BNP-32 (HUMAN) Properties

Density	1.52±0.1 g/cm3(Predicted)
RTECS	EE1534000
storage temp.	−20°C
form	powder
color	White to off-white
Water Solubility	Soluble in water at 1mg/ml
Sequence	H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Disulfide bridge: Cys10-Cys26)
CAS DataBase Reference	124584-08-3
EWG's Food Scores	1
FDA UNII	P7WI8UL647
ATC code	C01DX19
NCI Drug Dictionary	nesiritide

SAFETY

Risk and Safety Statements

WGK Germany	3

BNP-32 (HUMAN) price More Price(18)

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Sigma-Aldrich	B5900	Brain Natriuretic Peptide-32 human ≥97% (HPLC), powder	124584-08-3	0.5mg	$596	2024-03-01	Buy
Sigma-Aldrich	B5900	Brain Natriuretic Peptide-32 human ≥97% (HPLC), powder	124584-08-3	1mg	$1100	2024-03-01	Buy
Alfa Aesar	J66167	Brain Natriuretic Peptide (1-32), human	124584-08-3	1mg	$381	2023-06-20	Buy
Alfa Aesar	J66167	Brain Natriuretic Peptide (1-32), human	124584-08-3	0.5mg	$200	2021-12-16	Buy
Tocris	3522	Brain Natriuretic Peptide (1-32), human	124584-08-3	1	$432	2021-12-16	Buy

Product number	Packaging	Price	Buy
B5900	0.5mg	$596	Buy
B5900	1mg	$1100	Buy
J66167	1mg	$381	Buy
J66167	0.5mg	$200	Buy
3522	1	$432	Buy

BNP-32 (HUMAN) Chemical Properties,Uses,Production

Description

Nesiritide was introduced in the US as a new intravenous treatment for patients with acutely decompensated congestive heart failure who have dyspnea at rest or with minimal activity. Nesiritide is the first human recombinant form of the potent vasodilatory B-type natriuretic peptide (also known as brain natriuretic peptide), a naturally occurring 32 amino acid peptide with a disulfide-bonded 17 amino acid ring structure. Nesiritide binds to the Atype natriuretic peptide receptor on the surface of endothelial and smooth muscle cells stimulating production of the second messenger cGMP which mediates predominantly vascular smooth muscle cell relaxation. It also facilitates the elimination of sodium and water by the kidney and decreases the secretion of certain hormones, such as adrenalin, angiotensin II, aldosterone and endothelin, which provoke long-term detrimental effects including blood vessel constriction and blood pressure elevation. In clinical trials with heart failure patients, nesidtide dose-dependently reduced pulmonary capillary wedge pressure, right atrial pressure and systemic vascular resistance and increased cardiac index without affecting heart rate. The major adverse effect observed was dose-dependent hypotension. In a phase III comparative trial, nesiritide was found to be superior to iv. nitroglycerine in its haemodynamic effects as well as easier to administer and better tolerated. Nesiritide is cleared by proteolytic cleavage by the enzyme neutral endopeptidase NEP24.11 and by binding to the C-type natriuretic peptide receptor followed by endocytosis and intracellular lysosomal hydrolysis. Since it has a short half-life (18 min), nesiritide is administered as a 21μg/kg bolus infusion followed by a continuous maintenance infusion at 0.011μg/kg/min usually over 24-48 hours.

Originator

Scios (US)

Uses

Brain natriuretic peptide is originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis.

Uses

Treatment of congestive heart failure (renin-angiotensin system antagonist).

brand name

Natrecor (Biochemie, Austria).

General Description

The gene encoding brain natriuretic peptide-32 (BNP-32) is localized on human chromosome 1p36.22. It is implicated in several biological functions such as diuresis, natriuresis, hypotensive action and inhibition of aldosterone secretion. BNP-32 acts as a potential biomarker of high left ventricular-diastolic pressure in patients with symptomatic left ventricular (LV) dysfunction. Elevated expression of this protein is observed in acute myocardial infarction (AMI) patients.

Biochem/physiol Actions

Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis.

storage

Store at -20°C

BNP-32 (HUMAN) Preparation Products And Raw materials

Raw materials

Preparation Products

BNP-32 (HUMAN) Suppliers

Global( 108)Suppliers

Supplier	Tel	Email	Country	ProdList	Advantage
Sinoway Industrial co., ltd.	0592-5800732; +8613806035118	xie@china-sinoway.com	China	988	58
Alpha Biopharmaceuticals Co., Ltd	+86-15542445688	sales@alabiochem.com	China	888	58
Henan Tianfu Chemical Co.,Ltd.	+86-0371-55170693 +86-19937530512	info@tianfuchem.com	China	21639	55
Shenzhen Nexconn Pharmatechs Ltd	+86-755-89396905 +86-15013857715	admin@nexconn.com	China	10310	58
Hubei Jusheng Technology Co.,Ltd.	18871490254	linda@hubeijusheng.com	CHINA	28172	58
Alchem Pharmtech,Inc.	8485655694	sales@alchempharmtech.com	United States	63687	58
Cellmano Biotech Limited	0551-65326643 18156095617	info@cellmano.com	China	1000	58
Hebei Yanxi Chemical Co., Ltd.	+8617531190177	peter@yan-xi.com	China	5858	58
Hubei Ipure Biology Co., Ltd	+8613367258412	ada@ipurechemical.com	China	10319	58
Career Henan Chemica Co	+86-0371-86658258 +8613203830695	laboratory@coreychem.com	China	30241	58

Supplier	Advantage
Sinoway Industrial co., ltd.	58
Alpha Biopharmaceuticals Co., Ltd	58
Henan Tianfu Chemical Co.,Ltd.	55
Shenzhen Nexconn Pharmatechs Ltd	58
Hubei Jusheng Technology Co.,Ltd.	58
Alchem Pharmtech,Inc.	58
Cellmano Biotech Limited	58
Hebei Yanxi Chemical Co., Ltd.	58
Hubei Ipure Biology Co., Ltd	58
Career Henan Chemica Co	58

View Lastest Price from BNP-32 (HUMAN) manufacturers

Update time	Product	Price	Min. Order	Purity	Supply Ability	Manufacturer
2024-11-04	Nesiritide 124584-08-3	US $0.00-0.00 / box	1box	99%	100	Shandong Huizhihan Supply Chain Co., Ltd
2024-11-02	Nesiritide 124584-08-3	US $0.00 / g	1g	98%min	1000g	WUHAN FORTUNA CHEMICAL CO., LTD
2024-11-01	Nesiritide 124584-08-3	US $0.00-0.00 / kg	1kg	98%	20tons	Sinoway Industrial co., ltd.

Nesiritide
124584-08-3
US $0.00-0.00 / box
99%
Shandong Huizhihan Supply Chain Co., Ltd

Nesiritide
124584-08-3
US $0.00 / g
98%min
WUHAN FORTUNA CHEMICAL CO., LTD

Nesiritide
124584-08-3
US $0.00-0.00 / kg
98%
Sinoway Industrial co., ltd.

124584-08-3(BNP-32 (HUMAN))Related Search:

Lisinopril Dihydrate Nitrendipine Enalapril Moxonidine Nicorandil

Propafenone Milrinone Dobutamine hydrochloride Glucagon Irbesartan

(S)-Amlodipine Vasopressin HIRUDIN (54-65) (DESULFATED) Ziconotide Polyacetate Simendan

Liraglutide Octreotide Nesiritide acetate

1of4

Nesiritide [USAN:INN] SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26) SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26) BRAIN NATRIURETIC PEPTIDE (1-32), HUMAN BRAIN(B-TYPE) NATRIURETIC PEPTIDE-32 (HUMAN) BRAIN NATRIURETIC PEPTIDE, HUMAN BRAIN NATRIURETIC PEPTIDE-32 (HUMAN) B-TYPE (BRAIN) NATRIURETIC PEPTIDE-32 (HUMAN) BNP HUMAN BNP-32 (HUMAN) BNP (1-32), HUMAN BNP-32 (huMan) Brain Natriuretic Peptide-32 (huMan), Nesiritide Brain Natriuretic Peptide-32 (huMan), Nesiritide H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH Acetate salt (Disulfide bond) Nesiritide Nesiritide,Brain Natriuretic Peptide-32 human,BNP-32, >98% BNP-32 (human) hydrochloride Nesiritide (BNP-32) Brain Natriuretic Peptide (BNP) (1-32), human L-Histidine, L-seryl-L-prolyl-L-lysyl-L-methionyl-L-valyl-L-glutaminylglycyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-lysyl-L-methionyl-L-α-aspartyl-L-arginyl-L-isoleucyl-L-seryl-L-seryl-L-seryl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-lysyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-,... BNP-32 (HUMAN) USP/EP/BP Brain natriuretic pe 124584-08-3 Nesiritide [USAN:INN] Nesiritide，Brain Natriuretic Peptide-32 human，BNP-32 Nesiritide TFA L-Histidine, L-seryl-L-prolyl-L-lysyl-L-methionyl-L-valyl-L-glutaminylglycyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-lysyl-L-methionyl-L-α-aspartyl-L-arginyl-L-isoleucyl-L-seryl-L-seryl-L-seryl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-lysyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-, cyclic (10→26)-disulfide 124584-08-3 C143H224N50O42S4 Peptides Natriuretic Peptides Amino Acids and Peptides BioChemical Biochemicals and Reagents Elisa Kit-Mouse Elisa Kit