ChemicalBook >> CAS DataBase List >>GLP-2 (HUMAN)

GLP-2 (HUMAN)

CAS No.
223460-79-5
Chemical Name:
GLP-2 (HUMAN)
Synonyms
GLP-2;GLP-2(1-33);GLP-2 (HUMAN);GLP-2 (1-33) (HUMAN);GLP-2 (human) TFA salt;GLUCAGON-LIKE PEPTIDE-2;GLP-2(1-33)(HUMAN)?, BR;Glucagon-like peptide II;HADGSFSDEMNTILDNLAARDFINWLIQT;GLUCAGON-LIKE PEPTIDE II HUMAN
CBNumber:
CB4337472
Molecular Formula:
C165H254N44O55S
Molecular Weight:
3766.10906
MDL Number:
MFCD00081649
MOL File:
223460-79-5.mol
Last updated:2024-07-02 08:55:09

GLP-2 (HUMAN) Properties

storage temp. −20°C
solubility Soluble to 1 mg/ml in 5% NH4OH / water
form solid
color White to off-white
Water Solubility Soluble to 1 mg/ml in 5% NH4OH / water
Sequence H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
FDA UNII 0825W549JC

SAFETY

Risk and Safety Statements

Safety Statements  22-24/25
WGK Germany  3

GLP-2 (HUMAN) price More Price(9)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Tocris 2258 GLP-2(human) 223460-79-5 1 $314 2021-12-16 Buy
Usbiological G2040-37B Glucagon-like Peptide 2 223460-79-5 1mg $368 2021-12-16 Buy
Usbiological 355984 GLP2 223460-79-5 48Tests $588 2021-12-16 Buy
Usbiological G2040-37C Glucagon-like Peptide 2 223460-79-5 1mg $701 2021-12-16 Buy
Usbiological 152607 Glucagon Like Peptide 2 223460-79-5 96Tests $972 2021-12-16 Buy
Product number Packaging Price Buy
2258 1 $314 Buy
G2040-37B 1mg $368 Buy
355984 48Tests $588 Buy
G2040-37C 1mg $701 Buy
152607 96Tests $972 Buy

GLP-2 (HUMAN) Chemical Properties,Uses,Production

Structure

GLP-2 is a 33-aa peptide hormone, and has high sequence homology as a member of the glucagon family. The N-terminal two aa residues are cleaved off by dipeptidyl peptidase 4 (DPP-4). The N-terminal truncated GLP-2 fragment, GLP-2(3–33), acts as a competitive antagonist of the GLP-2 receptor, inhibiting nutrient- and GLP-2-induced mucosal growth in rodents. Phylogenetic analyses suggest that GLP-2 sequences have diversified most rapidly among the members of the glucagon family. Human GLP-2: Mr 3766.1, theoretical pI 4.17. GLP-2 is soluble in 5% NH4OH (-1mg/mL). GLP-2 is inactivated by DPP-4.	GLP-2 (HUMAN)

Gene, mRNA, and precursor

The human proglucagon gene, GCG, location 2q36– q37, spans approximately 9.4 kb and comprises six exons and five introns. It encodes a preproglucagon of 180 aa residues that contains glucagon, GLP-1, and GLP-2. The expression of proglucagon has been detected in the pancreatic α cells, intestinal L cells, and brain.

Synthesis and release

Glucagon, GLP-1, and GLP-2 are processed from proglucagon in pancreatic α cells and intestinal L cells in a tissue-specific manner. Prohormone convertases (PCs) are responsible for the tissue-specific processing. In pancreatic α cells, the major bioactive hormone is glucagon cleaved by PC2, whereas in the intestinal L cells, PC1/3 liberates GLP-1 and GLP-2 as bioactive hormones. As a result, GLP-1 and GLP-2 are coreleased from intestinal L cells in a 1:1 ratio following nutrient ingestion. GLP-2 secretion is also regulated by GIP and somatostatin, a gastrin-releasing peptide, and neural stimuli in a species-specific manner.

Receptors

The receptor of GLP-2 (GLP2R) is a seventransmembrane GPCR that belongs to a subclass of the family B. The human GLP-2 receptor gene, GLP2R, is located on chromosome 17 (17p13.3), and the human and rat GLP-2 receptor cDNAs were cloned from the intestine and hypothalamus in 1999. The GLP-2 receptor is highly specific to GLP-2, with increased cAMP production (EC50=0.58 nM), but not to related members of the glucagon peptide family. GLP-2 activates cAMP production in rodent and human cells transfected with the rat or human GLP-2 receptor.

Agonists and Antagonists

[Glycine2]-GLP-2 (a long-acting agonist), Teduglutide (a protease-resistant analog of GLP-2). There are no high-affinity specific GLP-2 receptor antagonists but GLP-2(11–33) and GLP-2(3–33) are known as antagonists.

Biological functions

Compared with GLP-1 and glucagon receptors, GLP-2 receptor expression is more restricted, occurring predominantly in the gastrointestinal tract, brain, and lung. In the rat, the GLP-2 receptor is most abundant in the jejunum, followed by the duodenum, ileum, colon, and stomach, and at very low levels in several other tissues including the central nervous system. The gastrointestinal tract, from the stomach to the colon, is the principal target for GLP-2 action. It has been suggested that GLP-2 may exert diverse actions involved mainly in the control of gastrointestinal growth and function (for example, epithelial integrity, motility, and secretion; local blood flow; and nutrient uptake and utilization). A stimulatory effect of GLP-2 on glucagon secretion from the human pancreas has also been reported. However, the GLP-2 receptor is not localized to the known target cells of GLP-2 tropic action, but to scattered enteroendocrine cells, enteric neurons, and subepithelial myofibroblasts. These results suggest that paracrine and/or neural pathways may mediate the intestinal tropic actions of GLP-2. It has been reported that GLP-2 acts through a neural pathway to affect intestinal crypt cell c-fos expression, and through a nitric oxide-dependent mechanism to affect intestinal blood flow. For GLP-2-induced epithelial growth, KGF and IGF-1, secreted from subepithelial myofibroblasts, act as essential mediators in response to GLP-2. GLP-2 receptor mRNA expression has also been found in the normal human cervix, but its functional relevance is not yet known. The GLP-2 receptor is also expressed in the central nervous system including the hypothalamus. Central GLP-2 is expected to be related to the regulation of feeding behavior. Several studies suggest that GLP2 exerts beneficial effects on glucose metabolism, especially in conditions related to the increased uptake of energy, such as obesity, at least in the animal model.

Description

GLP-2 is cosecreted with GLP-1 in response to nutrient ingestion. The principal role of GLP-2 appears to be the maintenance of the growth and absorptive function of the intestinal mucosal villus epithelium. GLP-2 was first identified as a novel peptide following the cloning of the proglucagon gene in the early 1980s, and subsequently the biosynthesis and release of GLP-2 were confirmed by isolation and characterization from the porcine and human small intestine. The biological role of GLP-2 as a stimulator of intestinal epithelial proliferation was first demonstrated in 1996.

Clinical Use

The pharmacological application of GLP-2 has been recognized and assessed in preclinical and clinical investigations to prevent or treat a number of intestinal diseases, including short bowel syndrome, Crohn’s disease, inflammatory bowel disease, chemotherapyinduced intestinal mucositis, colon carcinogenesis, and small bowel enteritis. The US Food and Drug Administration has accepted Teduglutide, an analog of GLP-2, for use in adult patients with short bowel syndrome.

storage

Store at -20°C

GLP-2 (HUMAN) Preparation Products And Raw materials

Raw materials

Preparation Products

GLP-2 (HUMAN) Suppliers

Global( 67)Suppliers
Supplier Tel Email Country ProdList Advantage
Shenzhen Nexconn Pharmatechs Ltd
+86-755-89396905 +86-15013857715 admin@nexconn.com China 10311 58
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
career henan chemical co
+86-0371-86658258 +8613203830695 factory@coreychem.com China 29820 58
BOC Sciences
16314854226; +16314854226 inquiry@bocsci.com United States 19743 58
Zhejiang J&C Biological Technology Co.,Limited
+1-2135480471 +1-2135480471 sales@sarms4muscle.com China 10522 58
Hangzhou Go Top Peptide Biotech
0571-88211921 sales1@gotopbio.com CHINA 2609 58
Chengdu Youngshe Chemical Co., Ltd.
+8618108235634 Cecilia@youngshechem.com China 2345 58
TargetMol Chemicals Inc.
+1-781-999-5354 support@targetmol.com United States 19973 58
Hebei Miaoyin Technology Co.,Ltd
+86-17367732028 +86-17367732028 kathy@hbyinsheng.com China 3581 58
Nanjing TGpeptide
+86-13347807150 +86-13347807150 support@tgpeptide.com China 3279 58

View Lastest Price from GLP-2 (HUMAN) manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
	GLP-2 (HUMAN) pictures 2020-02-14 GLP-2 (HUMAN)
223460-79-5
US $7.00 / KG 1KG 99% 100kg Career Henan Chemical Co
PREPROGLUCAGON (146-179) (HUMAN) TRIFLUOROACETATE SALT PREPROGLUCAGON (126-159) (HUMAN) PREPROGLUCAGON (146-178) (HUMAN) HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-ARG-OH H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH HADGSFSDEMNTILDNLAARDFINWLIQTKITDR GLP-2 GLP-2 (1-33) (HUMAN) GLP-2-ARG (HUMAN) TRIFLUOROACETATE SALT GLP-2 (HUMAN) GLUCAGON-LIKE PEPTIDE-2 GLUCAGON-LIKE PEPTIDE 2 ARG (HUMAN) GLUCAGON-LIKE PEPTIDE 2 (HUMAN) GLUCAGON-LIKE PEPTIDE II HUMAN M.W. 3766.14 C165H254N44O55S Glucagon Like Peptide-II (1-33), human GLP-2 (1-33) (huMan) Preproglucagon (146-178) (huMan), Proglucagon (126-158) (huMan), Glucagon-Like Peptide 2 (huMan) Preproglucagon (146-178) (huMan), Proglucagon (126-158) (huMan), Glucagon-Like Peptide 2 (huMan) Glucagon-like peptide II 1-33-Glucagon-like peptide II(human) GLP-2(1-33)(HUMAN)?, BR GLP-2(1-33)(human),GLP-2 (human),Glucagon-like peptide 2 (human),HADGSFSDEMNTILDNLAARDFINWLIQTKITD?, BR GLP-2, human HADGSFSDEMNTILDNLAARDFINWLIQTKITD Glucagon-Like Peptide (GLP) II, human GLP-2(1-33) 1-33-Glucagon-likepeptide II (human) (9CI) HADGSFSDEMNTILDNLAARDFINWLIQT GLP-2, human|Glucagon-Like Peptide-2 (1-33), human GLP-2 (human) TFA salt 223460-79-5 Cell Biology BioChemical Cell Signaling and Neuroscience Cytokines, Growth Factors and Hormones Hormones Other Protein/Peptide Hormones Glucagon receptor and related