ChemicalBook > Product Catalog >Biochemical Engineering >Polypeptide >CRF (HUMAN, RAT)

CRF (HUMAN, RAT)

CRF (HUMAN, RAT) Structure
CAS No.
86784-80-7
Chemical Name:
CRF (HUMAN, RAT)
Synonyms
CRF;CRH;crf41;mci028;ratcrf;humancrf;corticobiss;CRF Acetate;ratcrf(1-41);humancrf(1-41)
CBNumber:
CB1777095
Molecular Formula:
C208H344N60O63S2
Molecular Weight:
4757.45
MOL File:
Mol file
Modify Date:
2023/6/30 15:45:59

CRF (HUMAN, RAT) Properties

storage temp. −20°C
solubility H2O : 16.66 mg/mL (3.50 mM; Need ultrasonic and warming)
form White to off-white lyophilized solid
Water Solubility Soluble to 1.10 mg/ml in water

SAFETY

Risk and Safety Statements

Symbol(GHS) 
GHS07
Signal word  Warning
Hazard statements  H315-H319-H335
Precautionary statements  P280-P302+P352-P304+P340
WGK Germany  3
RTECS  GM7925000
10
HS Code  2937190000

CRF (HUMAN, RAT) price More Price(4)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich(India) C3042 Corticotropin Releasing Factor human, rat ≥95% (HPLC) 86784-80-7 0.1MG ₹20567.5 2022-06-14 Buy
Sigma-Aldrich(India) C3042 Corticotropin Releasing Factor human, rat ≥95% (HPLC) 86784-80-7 250μG ₹36285.4 2022-06-14 Buy
Sigma-Aldrich(India) C3042 Corticotropin Releasing Factor human, rat ≥95% (HPLC) 86784-80-7 0.5MG ₹68078.43 2022-06-14 Buy
Sigma-Aldrich(India) 05-23-0050 Corticotropin Releasing Factor, Human and Rat - CAS 86784-80-7 - Calbiochem An immunomodulatory neuropeptide that acts to release ACTH from the anterior pituitary and stimulates the sympathetic nervous system and adrenal medul 86784-80-7 1MG ₹50010 2022-06-14 Buy
Product number Packaging Price Buy
C3042 0.1MG ₹20567.5 Buy
C3042 250μG ₹36285.4 Buy
C3042 0.5MG ₹68078.43 Buy
05-23-0050 1MG ₹50010 Buy

CRF (HUMAN, RAT) Chemical Properties,Uses,Production

Uses

Treatment of symptoms associated with peritumoral edema in brain tumor patients.

General Description

Corticotropin-releasing factor is a 41-amino-acid polypeptide. It is expressed in neurons, hypothalamus?and amygdala.

CRF (HUMAN, RAT) Preparation Products And Raw materials

Raw materials

Preparation Products

CRF (HUMAN, RAT) Suppliers

Global( 152)Suppliers
Supplier Tel Country ProdList Advantage Inquiry
CLEARSYNTH LABS LTD. +91-22-45045900 Hyderabad, India 6351 58 Inquiry
Alpha Biopharmaceuticals Co., Ltd +86-15542445688 China 888 58 Inquiry
Shenzhen Nexconn Pharmatechs Ltd +86-755-89396905 +86-15013857715 China 10311 58 Inquiry
Cellmano Biotech Limited 0551-65326643 18156095617 China 999 58 Inquiry
career henan chemical co +86-0371-86658258 +8613203830695 China 29824 58 Inquiry
SIMAGCHEM CORP +86-13806087780 China 17367 58 Inquiry
Dideu Industries Group Limited +86-29-89586680 +86-15129568250 China 24099 58 Inquiry
BOC Sciences 16314854226; +16314854226 United States 19743 58 Inquiry
Zhejiang J&C Biological Technology Co.,Limited +1-2135480471 +1-2135480471 China 10522 58 Inquiry
Chengdu Youngshe Chemical Co., Ltd. +8618108235634 China 2345 58 Inquiry

Related articles

CORTICOTROPIN RELEASING FACTOR CORTICOTROPIN RELEASING FACTOR (CRF), HUMAN, RAT CORTICOTROPIN RELEASING FACTOR, HUMAN CORTICOTROPIN RELEASING FACTOR, HUMAN AND RAT CORTICOTROPIN RELEASING FACTOR HUMAN, RAT CRF, HUMAN AND RAT CRF (HUMAN, RAT) CRH CRF H-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 M.W. 4757.45 C208H344N60O63S2 Rat/human corticotropin-releasing factor Corticotropin-releasing factor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine- 25-L-glutamic acid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide- CRF (huMan, rat) CRF-41, CRH, Corticoliberin, Corticorelin CRF-41, CRH, Corticoliberin, Corticorelin CorticotropinReleasingFactorhuMan,rat,CorticotropinReleasingFactorhuMan H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 acetate salt CRF Acetate corticobiss corticotropin-releasingfactor(horse) corticotropin-releasingfactor(rat) corticotropin-releasingfactor(sheep),2-l-glutamicacid-22-l-alanine-23-l-arg corticotropin-releasinghormone(human) crf41 humancorticotropin-releasingfactor humancorticotropin-releasinghormone humancorticotropin-releasinghormone-41 humancrf humancrf(1-41) inine-25-l-glutamicacid-38-l-methionine-39-l-glutamicacid-41-l-isoleucinamid mci028 ratacth-releasinghormone ratcorticotropin-releasingfactor ratcorticotropin-releasingfactor-41 ratcrf ratcrf(1-41) rathypothalamiccrf CRF(human,Rat) Acetate Ser-Glu-Glu-Pro-Pro-IleSer-Leu-Asp-Leu-Thr-Phe-His-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 CRF(human,rat), CRH Corticotropin-releasing Factor TFA Salt (Human, rat) (Technical Grade) Corticotropin Releasing Factor human, rat, ≥95% (HPLC) Corticotropin-releasing factor (human) (Human CRF) Corticotropin Releasing Factor, Human and Rat - CAS 86784-80-7 - Calbiochem CRF (human, rat) acetate salt CRF (HUMAN, RAT) USP/EP/BP CRF (human and rat)/ Human CRF(1-41) CRF|Corticotropin Releasing Factor, human, rat Rabbit Anti-CRF antibody 86784-80-7 C208H344N60O63S2 C208H344N60O63S2XC2Hf3O2 BioChemical Amino Acids and Peptides Biochemicals and Reagents Releasing Factors