ADRENOMEDULLIN (HUMAN)
![ADRENOMEDULLIN (HUMAN) Structure](CAS/20180808/GIF/148498-78-6.gif)
- CAS No.
- 148498-78-6
- Chemical Name:
- ADRENOMEDULLIN (HUMAN)
- Synonyms
- ADM 1-52, HUMAN;humanadrenomedullin;ADRENOMEDULLIN (HUMAN);adrenomedullin 52 human;ADRENOMEDULLIN 1-52, HUMAN;Human adrenomedullin-(1-52)-NH2;Adrenomedullin (human)/ADM (1-52) (human), Adrenomedullin (1-52), human;YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (DISULFIDE BRIDGE: 16-21);Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-;TYR-ARG-GLN-SER-MET-ASN-ASN-PHE-GLN-GLY-LEU-ARG-SER-PHE-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-VAL-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-ASN-VAL-ALA-PRO-ARG-SER-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2
- CBNumber:
- CB4464257
- Molecular Formula:
- C264H406N80O77S3
- Molecular Weight:
- 6028.73324
- MOL File:
- 148498-78-6.mol
- Modify Date:
- 2024/3/27 11:49:37
storage temp. | -20°C |
---|---|
solubility | Soluble at 1mg/ml in 1% acetic acid |
form | powder |
Sequence | H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bond) |
SAFETY
Risk and Safety Statements
Symbol(GHS) | ![]() GHS08 |
---|---|
Signal word | Warning |
Hazard statements | H361 |
Precautionary statements | P201-P202-P281-P308+P313-P405-P501 |
WGK Germany | 3 |
RTECS | AV6800000 |
HS Code | 2937190000 |
ADRENOMEDULLIN (HUMAN) Chemical Properties,Uses,Production
Uses
Peptide elicits potent hypotensive effect, comparable to calcitonin gene-related peptide. Plays a key role in regulating endometrial angiogenesis.
General Description
Adrenomedullin (ADM) human comprises of 52 amino acids and has amine group in the C-terminal tyrosine residue. It also has a N-terminal ring structure and belongs to calcitonin peptide family. ADM has vasodilatory function and is mapped to human chromosome 11p15.4. Adrenomedullin is highly expressed in endothelial cells. Adrenomedullin controls a majority of cellular processes using cyclic adenosine monophosphate (cAMP) as a messenger. It interacts with calcitonin receptor-like receptor (CRLR) and receptor activity modifying protein 2 (RAMP2). ADM contributes to invasion activity in brain tumor cell lines. ADM signalling plays a key role in tumor progression, especially in acute myeloid leukemia.
Biochem/physiol Actions
Peptide elicits potent hypotensive effect, comparable to calcitonin gene-related peptide. Plays a key role in regulating endometrial angiogenesis.
ADRENOMEDULLIN (HUMAN) Preparation Products And Raw materials
Raw materials
Preparation Products
ADRENOMEDULLIN (HUMAN) Suppliers
Supplier | Tel | Country | ProdList | Advantage | Inquiry |
---|---|---|---|---|---|
Zibo Hangyu Biotechnology Development Co., Ltd | +86-0533-2185556 +8617865335152 | China | 10978 | 58 | Inquiry |
Alpha Biopharmaceuticals Co., Ltd | +86-15542445688 | China | 888 | 58 | Inquiry |
Shenzhen Nexconn Pharmatechs Ltd | +86-755-89396905 +86-15013857715 | China | 10312 | 58 | Inquiry |
Cellmano Biotech Limited | 0551-65326643 18156095617 | China | 999 | 58 | Inquiry |
career henan chemical co | +86-0371-86658258 +8613203830695 | China | 29826 | 58 | Inquiry |
Fuxin Pharmaceutical | +86-021-021-50872116 +8613122107989 | China | 10297 | 58 | Inquiry |
Hebei Yanxi Chemical Co., Ltd. | +86-17531190177; +8617531190177 | China | 5873 | 58 | Inquiry |
BOC Sciences | 16314854226; +16314854226 | United States | 19743 | 58 | Inquiry |
Zhejiang J&C Biological Technology Co.,Limited | +1-2135480471 +1-2135480471 | China | 10522 | 58 | Inquiry |
Chengdu Youngshe Chemical Co., Ltd. | +8618108235634 | China | 2345 | 58 | Inquiry |
148498-78-6(ADRENOMEDULLIN (HUMAN))Related Search:
1of4
chevron_right