ChemicalBook > Product Catalog >Biochemical Engineering >Amino Acids and Derivatives >Other Amino Acid Protection >Teriparatide acetate

Teriparatide acetate

Teriparatide acetate Suppliers list
Company Name: Sea Biological Co.,LTD
Tel: +86-13865152372 +86-13865152372
Email: tim@sea-biol.com
Products Intro: Product Name:Teriparatide Acetate
CAS:52232-67-4
Purity:>99.0% Package:1.0g;10.0g;100.0g;500.0g
Company Name: Cellmano Biotech Limited
Tel: 0551-65326643 18156095617
Email: info@cellmano.com
Products Intro: Product Name:Teriparatide Acetate
CAS:52232-67-4
Purity:98.0% min
Company Name: Hebei Xinsheng New Material Technology Co., LTD.
Tel: +86-16632316109
Email: xinshengkeji@xsmaterial.com
Products Intro: Product Name:Teriparatide acetate
CAS:52232-67-4
Purity:99.9% Package:1box;0.00;USD|25box;0.00;USD
Company Name: Zibo Hangyu Biotechnology Development Co., Ltd
Tel: +86-0533-2185556 +8617865335152
Email: Mandy@hangyubiotech.com
Products Intro: Product Name:Teriparatide acetate
CAS:52232-67-4
Purity:0.99 Package:1KG;85.00;USD|10KG;850.00;USD
Company Name: Hebei Weimiao Import and Export Trade Co., Ltd.
Tel: +undefined19948166995
Email: sale01@hbweimiao.com
Products Intro: Product Name:Teriparatide
CAS:52232-67-4
Purity:99% Package:1Box;166USD|5Box;164USD|10Box;160USD

Teriparatide acetate manufacturers

  • Teriparatide acetate
  • Teriparatide acetate pictures
  • $50.00/ kg
  • 2024-08-01
  • CAS:52232-67-4
  • Min. Order: 1kg
  • Purity: 98%
  • Supply Ability: 10 tons
  • Teriparatide acetate
  • Teriparatide acetate pictures
  • $1.00 / 1g
  • 2024-08-01
  • CAS:52232-67-4
  • Min. Order: 1g
  • Purity: 99%
  • Supply Ability: 100kg
  • Teriparatide acetate
  • Teriparatide acetate pictures
  • $0.00 / 1kit
  • 2024-07-25
  • CAS:52232-67-4
  • Min. Order: 1g
  • Purity: 98%min
  • Supply Ability: 1000g/month

Related articles

Teriparatide acetate Basic information
Application in Particular Diseases
Product Name:Teriparatide acetate
Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN
CAS:52232-67-4
MF:C172H278N52O47S2
MW:3890.49792
EINECS:640-978-1
Product Categories:Amino Acid Derivatives;EndocrinologyandHormones;proteins;Peptide;Hormones;Other Protein/Peptide Hormones;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;52232-67-4
Mol File:52232-67-4.mol
Teriparatide acetate Structure
Teriparatide acetate Chemical Properties
Melting point >205oC (dec.)
RTECS SQ7770000
storage temp. −20°C
solubility DMSO (Slightly), Water (Slightly)
form powder
color White to Off-White
Water Solubility Soluble to 0.40 mg/ml in water
SequenceH-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability:Hygroscopic
CAS DataBase Reference52232-67-4(CAS DataBase Reference)
Safety Information
WGK Germany 3
HS Code 2937190000
Hazardous Substances Data52232-67-4(Hazardous Substances Data)
MSDS Information
ProviderLanguage
SigmaAldrich English
Teriparatide acetate Usage And Synthesis
Application in Particular DiseasesIn Osteoporosis:
  • Teriparatide is a recombinant product representing the first 34 amino acids in human parathyroid hormone. Teriparatide increases bone formation, the bone remodeling rate, and osteoblast number and activity. Both bone mass and architecture are improved.
  • Teriparatide is FDA approved for postmenopausal women and men who are at high risk for fracture. Candidates for therapy include patients with a history of osteoporotic fracture, multiple risk factors for fracture, very low bone density (e.g., T-score <–3.5), or those who have failed or are intolerant of previous bisphosphonate therapy.
  • The drug reduces fracture risk in postmenopausal women, but no fracture data are available in men. Lumbar spine BMD increases are higher than with any other osteoporosis therapy. Although wrist BMD is decreased, wrist fractures are not increased.
  • Discontinuation of therapy results in a decrease in BMD, but some antifracture efficacy appears to be maintained. Sequential therapy with teriparatide followed by an antiresorptive agent (e.g., bisphosphonate) should be considered to maintain BMD gains.
  • The dose is 20 mcg administered subcutaneously in the thigh or abdominal area (see Table 3-4). The initial dose should be given with the patient either lying or sitting, in case orthostatic hypotension occurs. Each prefilled 3-mL pen device delivers a 20-mcg dose each day for up to 28 days; the pen device should be kept refrigerated.
  • Transient hypercalcemia rarely occurs. A trough serum calcium concentration is recommended 1 month after initiation of therapy.
  • Teriparatide is contraindicated in patients at baseline increased risk for osteosarcoma (e.g., Paget’s bone disease, unexplained alkaline phosphatase elevations, pediatric patients, young adults with open epiphyses, or patients with prior radiation therapy involving the skeleton).
DescriptionThe anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
UsesA fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.
General DescriptionTeriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
Biological Activityparathyroid hormone (1-34) (human), (c181h291n55o51s2), a peptide with the sequence h2n-svseiqlmhnlgkhlnsmervewlrkklqdvhnf-oh, mw= 4117.72. parathyroid hormone (pth), parathormone or parathyrin, is secreted by the chief cells of the parathyroid glands as a polypeptide containing 84 amino acids. it acts to increase the concentration of calcium (ca2+) in the blood, whereas calcitonin (a hormone produced by the parafollicular cells (c cells) of the thyroid gland) acts to decrease calcium concentration. pth acts to increase the concentration of calcium in the blood by acting upon the parathyroid hormone 1 receptor and the parathyroid hormone 2 receptor(1). parathyroid hormone regulates serum calcium, it enhances the release of calcium from the large reservoir contained in the bones(2). it enhances active reabsorption of calcium and magnesium from distal tubules and the thick ascending limb(3). it enhances the absorption of calcium in the intestine by increasing the production of activated vitamin d.figure1 formula of parathyroid hormone (1-34) (human)figure2 the parathyroid hormone (pth) system
Biochem/physiol ActionsParathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone, increasing the calcium:phosphate ratio in the kidney and promoting the absorption of calcium by the intestines. PTH is an anabolic agent that improves osteoblastic bone development. PTH 1-34 induces bone morphogenetic protein (BMP) gene transcription. Active N-terminal fragment of PTH (residues 1–34), has been used as a therapeutic for postmenopausal women with osteoporosis who are at high risk for fracture.
PharmacokineticsIf administered once daily or intermittently, teriparatide preferentially enhances osteoblastic function,and bone formation occurs. Continuous exposure to endogenous PTH may result in poor skeletal composition because of enhanced osteoclast-mediated bone resorption. After 18 months of treatment, lumbar BMD increased up to 12% in postmenopausal women. After 10 months of treatment, 53% of men had an increase of 5% or greater in spine BMD. The risk for developing new vertebral fractures was reduced by 65% after 21 months of treatment, and the number of nonvertebral fragility fractures was reduced by 53%.
Clinical UseIn 2002, the U.S. FDA approved teriparatide for the treatment of postmenopausal osteoporosis in patients who have a high risk of fracture as well as to increase bone mass in men with primary or hypogonadal osteoporosis who have a high risk of fracture. Teriparatide is recombinant human PTH 1-34, the biologically active portion of the endogenously produced preprohormone. Unlike the bisphosphonates, which are classified as bone restorative agents, teriparatide is the first approved bone-forming agent. Bone formation is possible because of the ability of this agent to increase the number of osteoblasts. Although teriparatide enhances the function of both osteoclasts and osteoblasts, the exposure incidence dictates its effect on the skeleton.
Side effectsTemporary increases in serum calcium levels occur following administration of teriparatide. As a result, this agent is contraindicated in patients who are predisposed to hypercalcemia. Some evidence suggests that these elevations in serum calcium levels may cause a patient who is taking digitalis to experience digitalis toxicity (39). Teriparatide should not be prescribed to patients with Paget's disease, children, young adults, women who are pregnant or nursing, and those patients who have received skeletal radiation therapy. Because of an increased incidence of osteosarcoma (malignant bone tumors) observed in rats, teriparatide also carries a black box warning
storageStore at -20°C
DosageTeriparatide acetate requires subcutaneous injection into the thigh or abdominal wall, and the recommended dose is 20 mcg once daily. If symptoms of orthostatic hypotension occur, it is administered while the patient is sitting or lying down. It is not recommended to use the drug for more than 2 years in the lifetime of the patient. Use teriparatide injection with caution in patients receiving digoxin. Transient hypercalcemia may predispose patients to digitalis toxicity.
References [1] Jeeho Sim. “Development of Clinical Weekly-Dose Teriparatide Acetate Encapsulated Dissolving Microneedle Patch for Efficient Treatment of Osteoporosis.” Polymers (2022).
Teriparatide acetate Preparation Products And Raw materials
Tag:Teriparatide acetate(52232-67-4) Related Product Information
Oxytocin Melanotan II Cosyntropin Terlipressin acetate Teriparatideacetate Lixisenatide Angiotensin acetate Pramlintide acetate ARG-LYS-GLU-VAL-TYR ACETATE SALT Desmopressin Secretin Acetate Triptorelin acetate Nafarelin Acetate Ganirelix Leuprorelin acetate Eptifibatide Acetate Eledoisin VAPREOTIDE