LL-37

Price	$7
Package	1KG

Product Details

Product Name: LL-37	CAS No.: 154947-66-7
Min. Order: 1KG	Purity: 99%
Supply Ability: 100KG	Release date: 2020/02/14

Product Name: LL-37

Synonyms: Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;[LL-37, 37 aa];Cathelicidin LL 37 (human);Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt)

CAS: 154947-66-7

MF: C205H340N60O53

MW: 0

EINECS: -0

Product Categories:

Mol File: Mol File

LL-37 Structure

Company Profile Introduction

Established in 2014,Career Henan Chemical Co. is a manufacturerspecializing in the sale of fine chemicals. Mainly deals in the sales of: Pharmaceutical intermediates OLED intermediates： Pharmaceutical intermediates; OLED intermediates;

Recommended supplier

Product name	Price		Suppliers	Update time
LL-37	$100.00/1Box	VIP1Y	American HealthyMorph LLC	2024-11-26
LL-37	$0.00/1BOX	VIP1Y	Shandong Huizhihan Supply Chain Co., Ltd	2024-10-30
LL37	$0.00/1G	VIP1Y	CONTIDE BIOTECH CO.,LTD	2024-10-17
LL-37	$80.00/1Box	VIP1Y	Qingdao Xinli Technology Development Co., Ltd.	2024-07-25
LL-37	$0.00/1kg	VIP2Y	Hebei Kingfiner Technology Development Co.Ltd	2024-06-24
LL-37	$35.00/1box		Hebei Xinsheng New Material Technology Co., LTD.	2024-05-28
LL-37	$85.00/1box	VIP1Y	Strong peptide cross-border e-commerce Co. LTD	2024-05-23
LL37	$0.00/1Box	VIP1Y	Shanghai Affida new material science and technology center	2024-05-09
LL-37	$22.00/1Box	VIP1Y	Shanghai Getian Industrial Co., LTD	2024-04-28
LL-37	$0.00/1kg	VIP1Y	Shaanxi TNJONE Pharmaceutical Co., Ltd	2024-04-16

Product Details

Company Profile Introduction

You may like

Recommended supplier

career henan chemical co