![CJC1295 Without DAC](/ProductImageEN/2022-04/Large/e4324c88-dcec-4719-9e2b-abb87d38451e.jpg)
CJC1295 Without DAC
Price | $30 |
Package | 1G |
Min. Order: | 100G |
Supply Ability: | 20 Tons |
Update Time: | 2023-07-19 |
Product Details
Product Name: CJC1295 Without DAC | CAS No.: 863288-34-0 |
Min. Order: 100G | Purity: 99% |
Supply Ability: 20 Tons | Release date: 2023/07/19 |
Product Specifications
CAS NO: | 863288-34-0 |
Product Name: | CJC1295 Without DAC |
Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;L-Tyrosyl-D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl |
Molecular Formula: | C152H252N44O42 |
Formula Weight: | 3367.89688 |
EINECS: | 206-141-6 |
Density: | 1.45 |
Appearance: | Solid powder |
Purity: | >98% |
Storage: | Keep in dark place,Inert atmosphere,Store in freezer, under -20°C |
Solubility: | Soluble in DMSO, not in water |
Shipping Condition: | Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs. |
Applications:
CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.
Company Profile
Wuhan wingroup Pharmaceutical Co.,Ltd located in Wuhan, Hubei Province, is a company dedicated to R&D,production and sales of chemical reagents, pharmaceutical intermediates, plantextracts and chemical raw materials. The company has a long-term cooperationwith Wuhan Research Institute and other universities. It is a pharmaceuticalenterprise oriented by the global pharmaceutical market demand and integratingthe research and development, industrialization and market operation ofinnovative drugs. At present, the company has submitted 10 domestic patents andone PCT patent (International Patent); And obtained the authorization of 7invention patents. The company has strong technical strength, advanced equipment,strict quality management system and high-quality after-sales service.
Over the years, our products have been widely sold to many countries and regions that we have established stable relations of cooperation with the traders and end users all around the world and have become a solid bridge among the suppliers, traders and end users.
Our Advantages
1. Quality control: We take quality as our life. We strictly control the quality of each process and establish a complete quality control system. We promise to bring 100% best quality products to consumers.
2. Trade capacity: We focus on chemical, biological medicine international trade for more than 10 years. Has the abundant product and the trade ability. Cooperative customers all over the world, good reputation.
3. transport capacity: We have professional freight agents, customs clearance agencies set up in the destination. Deliver your package safely. According to the customer's transport needs can choose: FEDEX UPS TNT DHL air charter and sea.
4. Carefully packing: 1kg, 5kg, 15kg, 20kg, 25kg can be packed in different specifications. Packaging can be customized according to customer requirements. Aluminum foil bag and carton. Ensure the safety of transportation. And free samples are available.
5. Quality service: We have a professional customer service team and after sales team. Being proficient in each language will guarantee your after-sale service.
Certificate
Hot Products
Hot Selling Products | ||
Item No | Product Name | CAS NO |
1 | New GBL | 7331-52-4 |
2 | 1,4-Butanediol (Bdo Liquid) | 110-63-4 |
3 | PMK powder&oil | 28578-16-7 |
4 | PMK powder | 13605-48-6 |
5 | New BMK Oil | 20320-59-6 |
6 | New BMK Powder | 5413-31-2 |
7 | New BMK Powder | 25547-51-7 |
8 | New BMK Powder | 10250-27-8 |
9 | 4-Piperidone | 40064-34-4 |
10 | N-(tert-Butoxycarbonyl)-4-piperidone | 79099-07-3 |
11 | 4'-Methylpropiophenone | 5337-93-9 |
12 | Valerophenone | 1009-14-9 |
13 | 2-bromo-4-methylpropiophenone | 1451-82-7 |
14 | Ethylmagnesium Bromide | 925-90-6 |
15 | Diphenylacetonitrile | 86-29-3 |
16 | 2-Dimethylaminoisopropyl chloride hydrochloride | 4584-49-0 |
17 | 2-(2-Chlorophenyl)-2-nitrocyclohexanone | 2079878-75-2 |
Packing&Shipping
1.Inner double plastic bags----25kg/Fiber drum (35*35*45cm, GW: 28kg, NW: 25kg);
2.Inner double plastic bags----5kg/Aluminum foil bag (GW: 6.5kg, NW: 5kg).
3.Inner double plastic bags----1kg/Aluminum foil bag (GW: 1.5kg,NW: 1kg).
1. We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post andother couriers, weight from 10g to 1000kg or even bulker.
2. Shipping details & shipping documents will be provided andsent by email.
3.We keep tracking the shippment until clients well received.
4.After years export shipping experience, with professional and experienced cooperated forwarders,we ensure that goods can be delivered in multiple ways safetly and efficiently.
FAQ
Q1:Can I get some samples?
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
Q2:Which kind of payment terms do you accept?
A: Payment by T/T, Western Union or Bitcoin.
Q3:Which transportation do we use?
A:Samples could be DHL, UPS, TNT, EMS, Fedex, and so on. For mass orders, it will be delivered by air or sea.
Q4:How about your delivery time?
Generally, it will take 3 to 5 days after receiving your advance payment.
Q5:How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.
Q6:How can we trust you?
A: You are always warm welcomed to visit us at any time.Before we start B2B, MIC has audited our company on-spot and approved our credit.
Q7:Do you test all your goods before delivery?
A:Yes, we have 100% test before delivery,International Authorized Third-Party Test for the products if you need are highly welcomed.
Company Profile Introduction
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$5.00/5mg |
VIP1Y
|
Hebei Ganmiao New material Technology Co., LTD
|
2024-06-27 | |
$65.00/1Box |
VIP1Y
|
Qingdao Xinli Technology Development Co., Ltd.
|
2024-05-30 | |
$0.10/20mg |
VIP1Y
|
Shanghai Likang New Materials Co., Limited
|
2024-05-28 | |
$85.00/1box |
VIP1Y
|
Strong peptide cross-border e-commerce Co. LTD
|
2024-05-23 | |
$50.00/1KG |
VIP1Y
|
hebei hongtan Biotechnology Co., Ltd
|
2024-05-13 | |
$50.00/1box |
VIP1Y
|
Hebei Zhuanglai Chemical Trading Co.,Ltd
|
2024-05-11 | |
$0.00/1Box |
VIP1Y
|
Shanghai Affida new material science and technology center
|
2024-05-09 | |
$0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-04-26 | |
$30.00/1000kit |
VIP1Y
|
Guangdong Tuoyuan Biotechnology Co., LTD
|
2024-04-25 | |
$0.00/1G |
VIP1Y
|
CONTIDE BIOTECH CO.,LTD
|
2024-04-23 |
- Since: 2021-05-12
- Address: No 135,xingye road,Jiangan District,Wuhan City,China
+86-13971566811
admin@whwingroup.com