CJC1295 NEW
Price | Get Latest Price | ||
Package | 100g | 500g | 1000g |
Min. Order: | 1g |
Supply Ability: | 100000tons |
Update Time: | 2023-11-03 |
Product Details
Product Name: CJC1295 | CAS No.: 863288-34-0 |
EC-No.: 206-141-6 | Min. Order: 1g |
Purity: 99% | Supply Ability: 100000tons |
Release date: 2023/11/03 |
-Product Description-
Our company has a variety of high-quality pharmaceutical intermediates, 100% Quality Guarantee.
If you are interested in us, please feel free to contact me:WhatsApp/Skype/Telegram:+86 15621811730.
Product Name: | CJC1295 |
Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG) |
CAS: | 863288-34-0 |
MF: | C152H252N44O42 |
MW: | 3367.89688 |
EINECS: | 206-141-6 |
Product Categories: | Peptides;CJC;863288-34-0 |
Mol File: | 863288-34-0.mol |
-Company Introduction-
We are Anhui Zhongda Biotechnology Co., Ltd., mainly engaged in pharmaceutical intermediates and various chemicals. It is one of the most dynamic foreign trade companies in the Chinese market. We have a pharmaceutical raw material production workshop and a reagent research and development center. Now has the most complete production line. In addition, we also have custom synthesis of various organic compounds as supplements. We can synthesize almost any chemical.
We always insist on survival by quality and development by reputation.
If you have any products you need, please feel free to contact me.
Hope to establish relations with you!
-Hot Selling Products-
-Packaging & Shipping-
Shipping method: FedEx, DHL, UPS, TNT, Postal Express.
We have a professional customs clearance team, you don't need to worry about any customs issues.We will be responsible for customs clearance taxes and other issues. Professional transportation, convenient and safe, 100% door-to-door delivery. If anything happens to your package, we promise to reship it for free. Enjoy the second free reissue policy.
Looking forward to cooperating with you, our high-quality products and thoughtful service will definitely make you satisfied!
Company Profile Introduction
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$0.00/10box |
VIP1Y
|
Shandong Hanjiang Chemical Co., Ltd
|
2024-10-12 | |
$20.00/1kg |
VIP1Y
|
Shaanxi Franta Biotechnology Co., Ltd
|
2024-09-23 | |
$45.00/1Box |
VIP1Y
|
Qingdao Xinli Technology Development Co., Ltd.
|
2024-07-25 | |
$5.00/5mg |
VIP1Y
|
Hebei Ganmiao New material Technology Co., LTD
|
2024-06-27 | |
$0.10/20mg |
VIP1Y
|
Shanghai Likang New Materials Co., Limited
|
2024-05-28 | |
$85.00/1box |
VIP1Y
|
Strong peptide cross-border e-commerce Co. LTD
|
2024-05-23 | |
$50.00/1KG |
VIP1Y
|
hebei hongtan Biotechnology Co., Ltd
|
2024-05-13 | |
$50.00/1box |
VIP1Y
|
Hebei Zhuanglai Chemical Trading Co.,Ltd
|
2024-05-11 | |
$0.00/1Box |
VIP1Y
|
Shanghai Affida new material science and technology center
|
2024-05-09 | |
$0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-04-26 |
- Since: 2023-06-08
- Address: No. 1858, Chuangxin Avenue, High-tech Zone, Hefei City, Anhui Province