![Teriparatide acetate](/ProductImageEN/2024-03/Large/f1f830ca-4282-40c8-8b99-a5c22dc6ab1a.jpg)
Teriparatide acetate NEW
Price | $3 | $2 | $1 |
Package | 1kg | 5kg | 10kg |
Min. Order: | 1kg |
Supply Ability: | 10 tons |
Update Time: | 2024-04-19 |
Product Details
Product Name: Teriparatide acetate | CAS No.: 52232-67-4 |
EC-No.: 640-978-1 | Min. Order: 1kg |
Purity: 99.9% | Supply Ability: 10 tons |
Release date: 2024/04/19 | |
Package: 500g,1kg,5kg,10kg,25kg |
Product description:
Product Name | Teriparatide acetate |
CAS Number | 52232-67-4 |
Synonyms | PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE |
Purity | 99% |
delivery | 8-10days |
Delivery time | Next day of payment |
Mode of transport | Sea, air and truck transport |
Our Advantages:
1. Overseas warehouses in many countries
2.Secure line transportation, fast delivery
3.Own laboratory and factory workshop
Company introduction
Shanghai Aosiris new Material Technology Co., LTD -After more than ten years of development since its establishment, the company has established a good reputation in the fields of analysis, chemistry, and medicine. Its products and services involve scientific research, culture and education, agriculture, forestry and environmental protection, inspection and quarantine, petrochemical industry, and bioengineering., medical pharmaceuticals, and food and beverage industries, the production varieties include general and special categories. The company pays attention to consolidating its internal strength, attracts a group of professional management, marketing and scientific and technological talents, and establishes a modern enterprise management system. It is based on outstanding talents, operates with integrity, is market-oriented, relies on science and technology, and wins by more. Sustainable development is the basis for cooperation, leading the laboratory equipment supply market to move towards modernization, specialization, standardization and scale.
When technology becomes the main productive force, and in the new century when humans have begun to move towards Mars, the moment the Mars rover comes into contact with the surface of Mars. When the genetic sequence appears before our eyes, the dawn of science and technology is leading mankind towards a new civilization, which is inseparable from the hard work and wisdom of our scientific and technological workers. In the busy scientific research work, suitable analytical and laboratory instruments are indispensable and powerful assistants for scientific researchers. However, the selection of analytical and laboratory instruments has become a thorny issue for the majority of scientific researchers.
Our company is committed to silently contributing to the success of the majority of chemists and medical scientists, and pushing the papers of domestic chemists to international forums. On the road to the International Chemistry Forum, we will lay out a red carpet for chemists, provide new technological products and good services for scientific research and production fields, promote the progress of the world's chemical and medical undertakings, and provide a platform for cultivating the world's most capable and talented people. Outstanding young people work hard to promote world civilization and progress.
Our qualifications
FAQ
1. Are you a manufacturer or trading company?
A: We are a manufacturer and welcome to visit our factory.
2. How to confirm the product quality before placing an order?
A: We can provide you with the sample. Also, we have the inspection report issued by the authoritative third-party testing agency.
3: What's your MOQ?
A: It depends on different products. We accept sample orders. Also for some products, we can provide you with a free sample.
4:Do you provide after-sales service?
A: We provide 24-hour customer service. If you encounter any product quality problems or transportation problems, please feel free to contact us.
5:How about delivery time and method?
A: We usually ship within 3-5 working days after payments.
We can make ships by sea, air, and express. Also can make door-to-door shipping.
6:How to solve the after-sale disputes?
A: We accept changing or refunding services if there is any quality problem.
Contact us
Company Profile Introduction
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$100.00/50kg |
VIP1Y
|
HEBEI SHENGSUAN CHEMICAL INDUSTRY CO.,LTD
|
2024-08-13 | |
$50.00/1kg |
VIP1Y
|
Shandong Deshang Chemical Co., Ltd.
|
2024-07-09 | |
$35.00/1box |
Hebei Xinsheng New Material Technology Co., LTD.
|
2024-05-14 | ||
$0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-05-09 | |
$10.00/1KG |
VIP1Y
|
Henan Fengda Chemical Co., Ltd
|
2024-04-28 | |
$0.00/1g |
VIP1Y
|
Shaanxi TNJONE Pharmaceutical Co., Ltd
|
2024-04-15 | |
$0.00/1Box |
VIP1Y
|
Shanghai Affida new material science and technology center
|
2024-04-12 | |
$26.00/1box |
VIP1Y
|
Shanghai Getian Industrial Co., LTD
|
2024-04-11 | |
$0.00/1g |
VIP1Y
|
airuikechemical co., ltd.
|
2024-04-03 | |
$1.00/1g |
VIP4Y
|
Dorne Chemical Technology co. LTD
|
2024-03-26 |
- Since: 2024-01-19
- Address: No. 18, Lane 65, Huandong 1st Road, Fengjing Town, Jinshan District, Shanghai