ChemicalBook > Product Catalog >API >Hormones and the Endocrine System >Pancreatic hormone and blood sugar regulation >Glucagon

Glucagon

Glucagon Structure
CAS No.
16941-32-5
Chemical Name:
Glucagon
Synonyms
Glucaton;Glucagon;GlucaGen;Glucagone;Glucagonum;GLUCAGON 37;GlucagonTFA;Glucagon HCl;Glukagon TFA;Glucagon 1-29
CBNumber:
CB6299499
Molecular Formula:
C153H225N43O49S
Molecular Weight:
3482.75
MOL File:
16941-32-5.mol
MSDS File:
SDS
Modify Date:
2024/7/10 15:15:42

Glucagon Properties

Density 1.53±0.1 g/cm3(Predicted)
storage temp. Keep in dark place,Sealed in dry,2-8°C
solubility Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
form powder
color White to off-white
Water Solubility Soluble to 1 mg/ml in water
InChIKey MASNOZXLGMXCHN-SXVMFYJYNA-N

SAFETY

Risk and Safety Statements

Symbol(GHS) 
GHS08,GHS07
Signal word  Danger
Hazard statements  H317-H332-H334
Precautionary statements  P261-P272-P280-P302+P352-P333+P313-P321-P363-P501-P261-P285-P304+P341-P342+P311-P501-P261-P271-P304+P340-P312
WGK Germany  3
3-10-21
HS Code  2937190000

Glucagon price More Price(5)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich(India) G2044 Glucagon synthetic, powder, suitable for cell culture 16941-32-5 1MG ₹11907.5 2022-06-14 Buy
Sigma-Aldrich(India) G2044 Glucagon synthetic, powder, suitable for cell culture 16941-32-5 5MG ₹32085.3 2022-06-14 Buy
Sigma-Aldrich(India) G2044 Glucagon synthetic, powder, suitable for cell culture 16941-32-5 25MG ₹116531.13 2022-06-14 Buy
Sigma-Aldrich(India) G1774 Glucagon ≥95% (HPLC), powder, synthetic 16941-32-5 0.1MG ₹21000.5 2022-06-14 Buy
Sigma-Aldrich(India) G1774 Glucagon ≥95% (HPLC), powder, synthetic 16941-32-5 1MG ₹106117.48 2022-06-14 Buy
Product number Packaging Price Buy
G2044 1MG ₹11907.5 Buy
G2044 5MG ₹32085.3 Buy
G2044 25MG ₹116531.13 Buy
G1774 0.1MG ₹21000.5 Buy
G1774 1MG ₹106117.48 Buy

Glucagon Chemical Properties,Uses,Production

Chemical Properties

White or almost white powder

Uses

Glucagon is an Amino Acid sequence.

Definition

Produced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in comm

Biological Functions

Glucagon, a 29-amino-acid, straight-chain polypeptide of α-cell pancreatic origin, triggers liver glycogenolysis and gluconeogenesis, thereby elevating glucose levels. The principal action of glucagon is the liver-mediated release into the blood of abnormally high concentrations of glucose, which causes hyperglycemia. This means that glucagon has an effect on blood glucose levels that is opposite to what occurs with insulin.

General Description

produced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit).

Clinical Use

Endogenous glucagon isproduced from the gene-derived protein PG in the cells ofthe islets of Langerhans in the pancreas. The core functionof this hormone is to renormalize blood glucose levels whenthey fall too low, by stimulating production from glycogen stores in liver and muscle, and stimulating hepatic gluconeogenesis.Glucagon also elicits biochemical processes (suchas fatty acid oxidation) that supply the needed precursors forgluconeogenesis. Glucagon supplied exogenously (i.e., injected)in response to emergency hypoglycemia acts rapidlyto elicit these same responses. Clinically, glucagon also providesan alternative to cholinergic antagonists for reducingGI motility and secretory activity during radiologic imagingprocedures.

Glucagon Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 297)Suppliers
Supplier Tel Country ProdList Advantage Inquiry
Manus Aktteva +91 (79) 6512-3395 New Delhi, India 581 34 Inquiry
CLEARSYNTH LABS LTD. +91-22-45045900 Hyderabad, India 6351 58 Inquiry
Apeloa production Co.,Limited +8619933239880 China 853 58 Inquiry
Cellmano Biotech Limited 0551-65326643 18156095617 China 999 58 Inquiry
Apextide Co Ltd +86-15300650552 +86-15300650552 China 71 58 Inquiry
GIHI CHEMICALS CO.,LIMITED +8618058761490 China 49999 58 Inquiry
Zhejiang Hangyu API Co., Ltd +8617531972939 China 2944 58 Inquiry
Shanghai Yunao International Trade Co., Ltd +8617621705551 China 265 58 Inquiry
Henan Bao Enluo International TradeCo.,LTD +86-17331933971 +86-17331933971 China 2503 58 Inquiry
qingdao future trading Co., Ltd +86-13335044410 +86-13335044410 China 110 58 Inquiry

Related articles

  • What is Glucagon?
  • Glucagon regulates blood sugar, which is the opposite of insulin.
  • Sep 25,2023
GLUCAGON 1-37 GLUCAGON (1-37) (PORCINE) GLUCAGON 37 GLUCAGON ACETATE HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH Glucagon 1-29 Glucagon(1-29) Human HCl GLUCAGON FROM HOG PANCREAS, PACKAGE A 2 MG* Glucagon, non animal source GLUCAGON EXTRACTED FROM PORCINE*PANCREAS GAMMA-IRRA His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr Glucagon 1-29 acetate OXYNTOMODULIN (PORCINE) OXYNTOMODULIN GASTRIN RELEASING PEPTIDE, PROCINE Glucagon【dog】 L-His-L-Ser-L-Gln-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Tyr-L-Ser-L-Lys-L-Tyr-L-Leu-L-Asp-L-Ser-L-Arg-L-Arg-L-Ala-L-Gln-L-Asp-L-Phe-L-Val-L-Gln-L-Trp-L-Leu-L-Met-L-Asn-L-Thr-OH Glucaton Glucagon (1-29) (human, rat, porcine) rGlucagon (2 x 2.94 mg) (recombinant Glucagon (Human)) (COLD SHIPMENT REQUIRED) Glucagon, USP rGlucagon, recombinant glucagon (human) Glucagon HCl Glucagon Glucagon (1-29), Human, Hydrochloride Salt Glucagon Hydrochlide GLP-1(7-37), Insulinotropin Glucagon (swine) PORCINE GLUCAGON Glucagon,Porcine glucagon, >95% Glucagon (GLU) Glucagon Acetate/Hcl Glucagon(1-29) Human Hydrochloride 4-Amino-1-{5-O-[(9E)-9-octadecenoyl]-β-D-arabinofuranosyl}-2(1H)- pyrimidinone piperazine-2,5-dione dioxime Glucagon impurity Glucagon USP/EP/BP Glucagon,Porcine glucagon GlucagonTFA GlucagonQ: What is Glucagon Q: What is the CAS Number of Glucagon Q: What is the storage condition of Glucagon Q: What are the applications of Glucagon Glucagone Glucagonum Glucagon 4HCl GlucaGen Glucagon (HUMAN) (2 x 2.94 mg) (COLD SHIPMENT REQUIRED) Glukagon TFA 16941-32-5 GLUCAGON; GLUCAGON ACETATE 16941-35-2 6941-35-2 C55H75N17O13C2H4O2 C153H225N43O49S Amino Acid Derivatives Peptide GlucagonIslet Stem Cell Biology Islet Stem Cell Differentiation Hormones