ChemicalBook > Product Catalog >Biochemical Engineering >Polypeptide >GLP-1 (7-37)

GLP-1 (7-37)

GLP-1 (7-37) Structure
CAS No.
106612-94-6
Chemical Name:
GLP-1 (7-37)
Synonyms
Tglp-1;GLP-1, 7-37;HuMan GLP-1;Glp-I (7-37);insulinotropin;GLP-1(7-37), >98%;Human GLP-1 (7-37);GLP-1 acetate salt;GLP-1 (7-37) (HUMAN);GLP-1(7-37) impurity
CBNumber:
CB1445727
Molecular Formula:
C151H228N40O47
Molecular Weight:
3355.67
MOL File:
106612-94-6.mol
Modify Date:
2024/7/2 8:55:01

GLP-1 (7-37) Properties

Density 1.48±0.1 g/cm3(Predicted)
storage temp. −20°C
solubility Water:30.0(Max Conc. mg/mL);8.34(Max Conc. mM)
form Lyophilized powder
color White to off-white
Water Solubility Soluble in water at 2mg/ml
Sequence H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
CAS DataBase Reference 106612-94-6

SAFETY

Risk and Safety Statements

Safety Statements  22-24/25
WGK Germany  3

GLP-1 (7-37) price More Price(1)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich(India) G9416 Glucagon-Like Peptide 1 Fragment 7-37 human ≥96% (HPLC) 106612-94-6 0.5MG ₹51602.78 2022-06-14 Buy
Product number Packaging Price Buy
G9416 0.5MG ₹51602.78 Buy

GLP-1 (7-37) Chemical Properties,Uses,Production

Description

GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion. GLP-1 (7-37) and derivatives GLP-1 (9-37) and GLP-1 (28-37) can reduce plaque inflammation and increase phenotypic characteristics of plaque stability in a murine model of atherosclerosis.

Uses

Glucagon-Like Peptide 1 Fragment 7-37 human has been used:

  • as a positive control for insulin secretion of pancreatic islets
  • to test its effect on insulin response in horse islets
  • in combination with mesenchymal stem cells (MSCs) test its protective effects in myocardial infarction

General Description

Glucagon-Like Peptide 1 Fragment 7-37 human (GLP-1-(7-37)) is an amino-truncated form of GLP-1.

Biochem/physiol Actions

Glucagon-Like Peptide 1 Fragment 7-37 human (GLP-1-(7-37)) interacts with the GLP-1 receptor (GLP-1r). It mediates insulin release by stimulating the cyclic AMP accumulation in islet cells GLP-l(7-37) is a potential therapeutic agent due to its insulin-secretagogue functionality.

in vitro

In vitro, truncated glucagon-like peptides [GLP-1(7-36)-amide and GLP-1(7-37)] increase insulin secretion in a glucose-dependent manner, and desensitization to the action of GLP-1(7-37) has been demonstrated acutely with high concentrations.

in vivo

GLP-1(7-37) (0.5, 5 or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion in rats. Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM.

GLP-1 (7-37) Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 186)Suppliers
Supplier Tel Country ProdList Advantage Inquiry
Cellmano Biotech Limited 0551-65326643 18156095617 China 999 58 Inquiry
Nantong Guangyuan Chemicl Co,Ltd +undefined17712220823 China 616 58 Inquiry
Wuhan senwayer century chemical Co.,Ltd +undefined-27-86652399 +undefined13627115097 China 892 58 Inquiry
Zibo Hangyu Biotechnology Development Co., Ltd +86-0533-2185556 +8617865335152 China 10978 58 Inquiry
Shanghai Getian Industrial Co., LTD +86-15373193816 +86-15373193816 China 269 58 Inquiry
Alpha Biopharmaceuticals Co., Ltd +86-15542445688 China 888 58 Inquiry
Henan Tianfu Chemical Co.,Ltd. +86-0371-55170693 +86-19937530512 China 21669 55 Inquiry
Hangzhou FandaChem Co.,Ltd. 008657128800458; +8615858145714 China 9337 55 Inquiry
ATK CHEMICAL COMPANY LIMITED +undefined-21-51877795 China 32760 60 Inquiry
career henan chemical co +86-0371-86658258 +8613203830695 China 29898 58 Inquiry
Insulinotropin (human) Peptide GLP-1 (human glucose-lowering peptide-1) Glp-I (7-37) Glucagon like peptide I (7-37) Glucagon-related peptide (oncorhynchus kisutch), 3-L-glutamic acid-6-L-phenylalanine-9-L-aspartic acid-12-L-serine-15-L-glutamic acid-16-glycine-21-L-isoleucine-24-L-alanine-27-L-valine-28-L-lysine-31-glycine- Tglp-1 GLP-1, 7-37 Preproglucagon 78-108 GLP-1 (7-37) (huMan, bovine, guinea pig, Mouse, rat) Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Preproglucag 7-37-Glucagon-like peptide I (human) Human GLP-1 (7-37) insulinotropin GLP-1, 7-37, Preproglucagon 78-108 Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-128) (huMan, bovine, guinea pig, Mouse, rat) Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-128) (huMan, bovine, guinea pig, Mouse, rat) HuMan GLP-1 7-37-Glucagon-likepeptide H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH acetate salt GLP-1 (7-37) Acetate | Glucagon-Like Peptide 1 l-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alany PROGLUCAGON (78-108) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) PREPROGLUCAGON 78-108 HUMAN PREPROGLUCAGON (98-128) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) INSULINOTROPIN (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG GLP-1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG) GLP-1 (7-37) (HUMAN) GLP-1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLUCAGON-LIKE PEPTIDE 1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG) GLUCAGON LIKE PEPTIDE-I (7-37), HUMAN GLUCAGON-LIKE PEPTIDE 1, FRAGMENT 7-37 HUMAN GLUCAGON-LIKE PEPTIDE 1 (7-37) GLUCAGON-LIKE PEPTIDE 1 (7-37) (HUMAN) GLUCAGON-LIKE PEPTIDE 1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLP-1(7-38), Insulinotropin Glucagon-Like Peptide (GLP) I (7-37) GLP-1(7-37), >98% GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, >98% GLP-1(7-37) impurity H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH USP/EP/BP H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GL... TIANFUCHEM--106612-94-6---H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR- LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-LE-ALA-TRP-LEU-VAL- LYS-GLY-ARG-GLY-OH H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH Insulinotropin acetate [GLP-1 (7-37) GLP-1 acetate salt Glucagon-Like Peptide-1 (7-37)|GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) 106612-94-6 C151H228N40O47 peptides pharm peptide